Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_686205.6 | Gene: | igsf9b / 553348 | ZFINID: | ZDB-GENE-060810-28 | Length: | 2021 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 42/202 - (20%) |
---|---|---|---|
Similarity: | 75/202 - (37%) | Gaps: | 59/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 279 LTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPN 343
Fly 344 NWRLKITNVKKDDEAIYECQIS------THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDS 402
Fly 403 TLQLS------CVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
Fly 462 DSGNYTC 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 16/85 (19%) |
Ig | 279..378 | CDD:299845 | 20/104 (19%) | ||
Ig | 400..471 | CDD:299845 | 19/75 (25%) | ||
IG_like | 402..480 | CDD:214653 | 18/73 (25%) | ||
igsf9b | XP_686205.6 | Ig | 27..132 | CDD:299845 | |
IG_like | 148..227 | CDD:214653 | 20/104 (19%) | ||
IGc2 | 156..217 | CDD:197706 | 15/84 (18%) | ||
Ig | 237..323 | CDD:299845 | 19/87 (22%) | ||
IG_like | 237..323 | CDD:214653 | 19/87 (22%) | ||
Ig | 345..411 | CDD:143165 | |||
IG_like | 435..507 | CDD:214653 | |||
IGc2 | 437..496 | CDD:197706 | |||
FN3 | 512..603 | CDD:238020 | |||
FN3 | 621..709 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |