DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and igsf9b

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:202 Identity:42/202 - (20%)
Similarity:75/202 - (37%) Gaps:59/202 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPN 343
            |.|..|.|:.|:|........|:.|.::.:..|.::....|                        
Zfish   151 LEVLLGESLTLHCDAHGNPKPTIIWRKYLSAAEKQEEIQVL------------------------ 191

  Fly   344 NWRLKITNVKKDDEAIYECQIS------THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDS 402
            |..|.::.|.::...||:|.:|      ||     ...|.|..|.::|:...           |:
Zfish   192 NETLSLSKVTRETAGIYKCHVSNSEGNLTH-----STQLQV
KGPPIIIIAPE-----------DT 240

  Fly   403 TLQLS------CVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
            |:.:|      |.........:..:||...|:.:.::.:.    :.:::.||   ||.|:.:...
Zfish   241 TMNMSQDAVLQCQAEAYPSNLTYEWWKQGQNVYHIEILKS----RVKILVDG---TLLISALIPD 298

  Fly   462 DSGNYTC 468
            |||||||
Zfish   299 DSGNYTC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 16/85 (19%)
Ig 279..378 CDD:299845 20/104 (19%)
Ig 400..471 CDD:299845 19/75 (25%)
IG_like 402..480 CDD:214653 18/73 (25%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845
IG_like 148..227 CDD:214653 20/104 (19%)
IGc2 156..217 CDD:197706 15/84 (18%)
Ig 237..323 CDD:299845 19/87 (22%)
IG_like 237..323 CDD:214653 19/87 (22%)
Ig 345..411 CDD:143165
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.