DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and KIRREL1

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:287 Identity:55/287 - (19%)
Similarity:101/287 - (35%) Gaps:106/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EDVQRIGQATNLTVQAGSSIHLNCR-ISLLQDKTVSWVRHNTQDEG--------KD--------- 314
            ||. ||.....:.:|||:..:|.|| .:.....|:.|.|..||.||        ||         
Human   121 EDT-RIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQ 184

  Fly   315 ---NGNALDL------------LTVGMHTYTGDKRYKMEFQYPNNWRLKI--TNVKKDDEAIYEC 362
               |...||:            :..|..|     ..:::..:|....|.|  ..|::.:..::.|
Human   185 LLINPTDLDIGRVFTCRSMNEAIPSGKET-----SIELDVHHPPTVTLSIEPQTVQEGERVVFTC 244

  Fly   363 QISTHPPRV----------------------------------------------IQINLHVNAP 381
            |.:.:|..:                                              ..:|:|. ||
Human   245 QATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHF-AP 308

  Fly   382 KVMIVDEVGDPLQEKYYEIDSTLQLSCV-VRNVAMTSSVVFWKHMDNILNYDVTRGG----VSVK 441
            ::::     || :....:|.|.:.|:|| |.|..:|   :.|...|:  |......|    .::.
Human   309 RIVV-----DP-KPTTTDIGSDVTLTCVWVGNPPLT---LTWTKKDS--NMGPRPPGSPPEAALS 362

  Fly   442 TELMEDGANSTLSIAKISKTDSGNYTC 468
            .:::.:  ::.|.:..:::.|:|.|||
Human   363 AQVLSN--SNQLLLKSVTQADAGTYTC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 26/121 (21%)
Ig 279..378 CDD:299845 28/179 (16%)
Ig 400..471 CDD:299845 18/74 (24%)
IG_like 402..480 CDD:214653 17/72 (24%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236 17/85 (20%)
I-set 223..304 CDD:254352 6/80 (8%)
Ig_2 227..305 CDD:290606 7/77 (9%)
Ig_2 311..405 CDD:290606 20/90 (22%)
IG_like 314..405 CDD:214653 19/82 (23%)
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.