DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and NTM

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:208 Identity:49/208 - (23%)
Similarity:84/208 - (40%) Gaps:43/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 RIGQAT------NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYT 330
            |.|.||      |:||:.|.|..|.|.|.....: |:|:..:|            :|..|...:.
Human    32 RSGDATFPKAMDNVTVRQGESATLRCTIDNRVTR-VAWLNRST------------ILYAGNDKWC 83

  Fly   331 GDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVN-APKVMIVDEVGDPL 393
            .|.|..:.......:.::|.||...||..|.|.:.| :.|:..:::|.|. :||::   |:...:
Human    84 LDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIV---EISSDI 145

  Fly   394 QEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKI 458
            .   ....:.:.|:|:.  .......|.|:|        ::...|...:|      :..|.|..|
Human   146 S---INEGNNISLTCIA--TGRPEPTVTWRH--------ISPKAVGFVSE------DEYLEIQGI 191

  Fly   459 SKTDSGNYTCSIS 471
            ::..||:|.||.|
Human   192 TREQSGDYECSAS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 27/102 (26%)
IG_like 278..365 CDD:214653 22/86 (26%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 0/3 (0%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 16/70 (23%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
NTMNP_001338930.1 Ig 44..132 CDD:472250 25/100 (25%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 19/91 (21%)
Ig 223..307 CDD:472250
Ig strand B 239..243 CDD:409353
Ig strand C 252..256 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.