DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and OPCML

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:214 Identity:55/214 - (25%)
Similarity:85/214 - (39%) Gaps:58/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 RIGQAT------NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHT 328
            |.|.||      |:||:.|.|..|.|.|   .|:.  |:|:..:|            :|..|...
Human    32 RSGDATFPKAMDNVTVRQGESATLRCTI---DDRVTRVAWLNRST------------ILYAGNDK 81

  Fly   329 YTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNAPKVMI------- 385
            ::.|.|..:....|..:.:.|.||...||..|.|.:.| :.|:..:::|.|..|..::       
Human    82 WSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDIT 146

  Fly   386 VDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGAN 450
            |:|            .|::.|.|:.  :......|.|:|    |:....:|.||      ||   
Human   147 VNE------------GSSVTLLCLA--IGRPEPTVTWRH----LSVKEGQGFVS------ED--- 184

  Fly   451 STLSIAKISKTDSGNYTCS 469
            ..|.|:.|.:..||.|.||
Human   185 EYLEISDIKRDQSGEYECS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 29/104 (28%)
IG_like 278..365 CDD:214653 24/88 (27%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/5 (20%)
Ig strand E 345..349 CDD:409382 0/3 (0%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 20/68 (29%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 27/102 (26%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 23/96 (24%)
Ig 224..312 CDD:472250
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.