DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and NCAM1

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:230 Identity:52/230 - (22%)
Similarity:89/230 - (38%) Gaps:53/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 IGQATNLTV---------QAGSSIHLNCRIS-LLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMH 327
            :|.|.:|.|         ..|.|....|::: ..:||.:||.        ..||..|.       
Human    14 LGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWF--------SPNGEKLT------- 63

  Fly   328 TYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNA-PKVMIVDEVGD 391
              ...:|..:.:...::..|.|.|...||..||:|.::.......:..::|.. .|:|..:.   
Human    64 --PNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNA--- 123

  Fly   392 PLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKH--MDNILNYDVTRGGVSVKTELMEDGANSTLS 454
            |..:::.|.:..:.:..||.::..|   :.|||  .|.||..||....:|          |:.|.
Human   124 PTPQEFREGEDAVIVCDVVSSLPPT---IIWKHKGRDVILKKDVRFIVLS----------NNYLQ 175

  Fly   455 IAKISKTDSGNYTC-------SISEFQNFTIVVHI 482
            |..|.|||.|.|.|       ....|::..::|::
Human   176 IRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/96 (22%)
Ig 279..378 CDD:299845 21/108 (19%)
Ig 400..471 CDD:299845 22/79 (28%)
IG_like 402..480 CDD:214653 23/86 (27%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 22/111 (20%)
IG 124..190 CDD:214652 23/78 (29%)
Ig 211..307 CDD:325142 52/230 (23%)
Ig 306..438 CDD:325142
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.