DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and opcml

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:274 Identity:62/274 - (22%)
Similarity:92/274 - (33%) Gaps:105/274 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
            |:||:.|.|..|.|.   :.:|.  |:|:...|            :|..|...::.|.|..:...
Zfish    41 NITVRQGDSAVLKCS---MDNKVSRVAWLNRTT------------ILFTGNEKWSLDPRVVLLNT 90

  Fly   341 YPNNWRLKITNVKKDDEAIYECQISTH-PPRVIQINLHVNAPKVMI-------VDE--------- 388
            ..|.:.:||.||...||..|.|.|.|: .|...:::|.|..|..::       |:|         
Zfish    91 AVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCL 155

  Fly   389 -VGDP-----------------LQEKYYEI-----DSTLQLSCV---------VRNVAMTSSV-- 419
             :|.|                 .:.:|.|:     |.:....|:         ||.|.:|.:.  
Zfish   156 AIGRPEPSILWKFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPP 220

  Fly   420 ----------------VFW--------------KHMDNILNYDVTRGGVSVKTELMEDGANSTLS 454
                            |.|              |....|||     |...||.|  ..|..|.|:
Zfish   221 VISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILN-----GFNGVKIE--NKGKQSMLT 278

  Fly   455 IAKISKTDSGNYTC 468
            ...:|:.|.|||||
Zfish   279 FFNVSEEDYGNYTC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 24/88 (27%)
Ig 279..378 CDD:299845 27/101 (27%)
Ig 400..471 CDD:299845 26/115 (23%)
IG_like 402..480 CDD:214653 25/108 (23%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 28/102 (27%)
IG_like 41..129 CDD:214653 28/102 (27%)
IG_like 139..216 CDD:214653 11/76 (14%)
IGc2 146..202 CDD:197706 7/55 (13%)
I-set 219..307 CDD:254352 20/81 (25%)
ig 223..307 CDD:278476 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.