Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005580.1 | Gene: | opcml / 449538 | ZFINID: | ZDB-GENE-040927-3 | Length: | 342 | Species: | Danio rerio |
Alignment Length: | 274 | Identity: | 62/274 - (22%) |
---|---|---|---|
Similarity: | 92/274 - (33%) | Gaps: | 105/274 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
Fly 341 YPNNWRLKITNVKKDDEAIYECQISTH-PPRVIQINLHVNAPKVMI-------VDE--------- 388
Fly 389 -VGDP-----------------LQEKYYEI-----DSTLQLSCV---------VRNVAMTSSV-- 419
Fly 420 ----------------VFW--------------KHMDNILNYDVTRGGVSVKTELMEDGANSTLS 454
Fly 455 IAKISKTDSGNYTC 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 24/88 (27%) |
Ig | 279..378 | CDD:299845 | 27/101 (27%) | ||
Ig | 400..471 | CDD:299845 | 26/115 (23%) | ||
IG_like | 402..480 | CDD:214653 | 25/108 (23%) | ||
opcml | NP_001005580.1 | Ig | 41..129 | CDD:299845 | 28/102 (27%) |
IG_like | 41..129 | CDD:214653 | 28/102 (27%) | ||
IG_like | 139..216 | CDD:214653 | 11/76 (14%) | ||
IGc2 | 146..202 | CDD:197706 | 7/55 (13%) | ||
I-set | 219..307 | CDD:254352 | 20/81 (25%) | ||
ig | 223..307 | CDD:278476 | 20/77 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |