DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:225 Identity:60/225 - (26%)
Similarity:95/225 - (42%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDN 315
            |:.|:||....:..|   |.:.||...|:|..||....|.|.:..|....|.|:|.:.|      
  Fly    23 STQNQHHESSSQLDP---DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQ------ 78

  Fly   316 GNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNA 380
                .:|.:.....|.:.|..:..|..:.|:|||:.:::.|...|.|||:|.|.:.....:.|..
  Fly    79 ----TVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQV 139

  Fly   381 PKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDN--ILNYDVTRGGVSVKTE 443
            |..:|.:|....|..:..| |:|  |:|  :........|.|:..|.  ||   :.:.|   ..|
  Fly   140 PPDIINEESSADLAVQEGE-DAT--LTC--KATGNPQPRVTWRREDGEMIL---IRKPG---SRE 193

  Fly   444 LM--EDGANSTLSIAKISKTDSGNYTCSIS 471
            ||  |....|:|.:.::.:...|.|.|..|
  Fly   194 LMKVESYNGSSLRLLRLERRQMGAYLCIAS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 23/86 (27%)
Ig 279..378 CDD:299845 25/98 (26%)
Ig 400..471 CDD:299845 19/74 (26%)
IG_like 402..480 CDD:214653 19/74 (26%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/101 (27%)
Ig 47..129 CDD:299845 26/91 (29%)
Ig 140..238 CDD:299845 25/95 (26%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.