DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-gamma

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:225 Identity:60/225 - (26%)
Similarity:95/225 - (42%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDN 315
            |:.|:||....:..|   |.:.||...|:|..||....|.|.:..|....|.|:|.:.|      
  Fly    23 STQNQHHESSSQLDP---DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQ------ 78

  Fly   316 GNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNA 380
                .:|.:.....|.:.|..:..|..:.|:|||:.:::.|...|.|||:|.|.:.....:.|..
  Fly    79 ----TVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQV 139

  Fly   381 PKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDN--ILNYDVTRGGVSVKTE 443
            |..:|.:|....|..:..| |:|  |:|  :........|.|:..|.  ||   :.:.|   ..|
  Fly   140 PPDIINEESSADLAVQEGE-DAT--LTC--KATGNPQPRVTWRREDGEMIL---IRKPG---SRE 193

  Fly   444 LM--EDGANSTLSIAKISKTDSGNYTCSIS 471
            ||  |....|:|.:.::.:...|.|.|..|
  Fly   194 LMKVESYNGSSLRLLRLERRQMGAYLCIAS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 33/116 (28%)
IG_like 278..365 CDD:214653 23/86 (27%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 19/74 (26%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 26/91 (29%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 24/94 (26%)
Ig strand B 160..164 CDD:409562 2/5 (40%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562
IG_like 247..355 CDD:214653
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.