DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Dscam3

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:623 Identity:125/623 - (20%)
Similarity:191/623 - (30%) Gaps:227/623 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDCAVPNLIR--------------LLLLIATIMGSGLVQAKT--IYDSVNMIQSLDALV------ 74
            :.||:|..:|              ||..::.:.|..:|.|.:  :|  |..::|.|.|:      
  Fly   157 IKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGDLY--VRSVRSEDGLMKFSCLV 219

  Fly    75 ------EPRETTKVPLQT-------TPAT--PPTAHAHIH--NQVS----------TLRSSYEDS 112
                  |.:.:..|.||.       .|.|  .|....|:.  |.|.          .:.:.|..|
  Fly   220 TNTLNGERQRSDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHLPCNIQGNPFPIFTWYRVS 284

  Fly   113 DDGVDGDYVIPESQ-----TSTVAILDQDSSMKGQDMESLSLQAGSGTVSPKSSPDS--SGHKKN 170
            |..  ..|.||.||     .:.:.|.:.|....|:.:...|.|.|...:..:.|.:|  |.|   
  Fly   285 DSA--ALYPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVH--- 344

  Fly   171 ASFQQIGSQNVNALVPATVATTSS----------GLPSSSNASLATPTEPAR------------- 212
             ...|:...|..........||.|          |.|..:|.:|.|..:..|             
  Fly   345 -ILPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVG 408

  Fly   213 NRSTG----LVRNSAVKVDSKHPLSKGQKTDAPMLNYIF-------------------------- 247
            .|..|    ||.|......:...|..|.  ..|.|.|.|                          
  Fly   409 RRDRGVYQCLVENQRASAQAMAELKLGD--TVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFA 471

  Fly   248 ---------------------------DTFSSANKHH--------------------HHDQR--- 262
                                       |..|..|..|                    .|..|   
  Fly   472 WLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNV 536

  Fly   263 YGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMH 327
            |||.:  |:.||.   :...||..|.::|..:....:.:.|.:.:.:            ||...|
  Fly   537 YGPPY--VRAIGP---IKAVAGEDIIVHCPFAGYPVEQIRWEKAHQE------------LTTSNH 584

  Fly   328 TYTGDKRYKMEFQYPNNWRLKITNVKKD-DEAIYECQIST----HPPRVIQINLHVNAPKVMIVD 387
                   |::. ...:..:|.|.||:.. |:.||.|.:.:    ...|.:|:|  ||:|.|:...
  Fly   585 -------YELA-SVADGGQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLN--VNSPPVIEPF 639

  Fly   388 EVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVF-WKHMDNILNYDVTRGGVSVKTELM----ED 447
            :....|||     ....|::|.|.:..|  .:.| ||..|:           |:.:.|.    ::
  Fly   640 KFPKNLQE-----GGRAQITCAVSSGDM--PIYFSWKKDDS-----------SIPSSLQITEKKE 686

  Fly   448 GANSTLSIAKISKTDSGNYTCSISEFQ---NFTIVVHI 482
            ...|.|....||...||.|||..|...   |:|..:.:
  Fly   687 EFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQV 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/87 (20%)
Ig 279..378 CDD:299845 20/103 (19%)
Ig 400..471 CDD:299845 19/75 (25%)
IG_like 402..480 CDD:214653 22/85 (26%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 20/92 (22%)
Ig 264..334 CDD:143165 15/71 (21%)
I-set 345..433 CDD:254352 16/87 (18%)
Ig 358..431 CDD:143165 14/72 (19%)
Ig 456..533 CDD:143165 5/76 (7%)
IGc2 553..619 CDD:197706 16/85 (19%)
I-set 634..724 CDD:254352 26/107 (24%)
ig 645..712 CDD:278476 23/84 (27%)
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.