DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr5

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:363 Identity:97/363 - (26%)
Similarity:155/363 - (42%) Gaps:82/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VNALVPATVATTSSGL----PSSSNA-------------------SLATPTEPARNRSTGLVRNS 222
            |.|...:|.||.||.|    .|:|.|                   .|..|.:....||:....:.
  Fly     7 VRATFTSTTATESSPLIGKVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHL 71

  Fly   223 AVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQA--GS 285
            |...:              :.|.|.|.:.:.:          |.|::      .|:..|.|  |:
  Fly    72 AAAEE--------------LSNLIPDNYDAID----------PVFDN------TTDREVIAALGT 106

  Fly   286 SIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRY-KMEFQYPNNWRLKI 349
            :..|:||:..|.|:.|||:|...          |.:||:|:.|||.|:|: .......:.|.|||
  Fly   107 TARLHCRVRHLGDRAVSWIRQRD----------LHILTIGIMTYTNDQRFLARHIDNSDEWVLKI 161

  Fly   350 TNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVA 414
            .:|::.|..:||||:||.|...:...|.|...|..|:..     :|.:.:..|.:.|:|:.....
  Fly   162 VSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILAN-----RELFIQSGSDINLTCIAPQAP 221

  Fly   415 MTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIV 479
            ...:.:.| |.|..|..|..|||:.|::|  :....|.|.|:::..|||||||||.....:.::.
  Fly   222 GPYTHMLW-HKDTELVSDSARGGIRVESE--QQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVF 283

  Fly   480 VHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVL 517
            |||:..|..|.:.|  .:|      :.::|..:.||:|
  Fly   284 VHIIKSEQHAAMQH--ELG------SRLLLPPLPLLLL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 31/89 (35%)
Ig 279..378 CDD:299845 35/101 (35%)
Ig 400..471 CDD:299845 25/70 (36%)
IG_like 402..480 CDD:214653 25/77 (32%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 36/105 (34%)
IG_like 98..179 CDD:214653 32/90 (36%)
IG_like 206..278 CDD:214653 25/74 (34%)
Ig 211..278 CDD:143165 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444726
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.