DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Ama

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:267 Identity:51/267 - (19%)
Similarity:89/267 - (33%) Gaps:82/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTV 281
            ||:...|:.:||        ...||:::.|                             :.::..
  Fly    17 GLIFCLAISLDS--------VLSAPVISQI-----------------------------SKDVVA 44

  Fly   282 QAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEF-QYPNN- 344
            ..|.|:..||.:..:...:|||.:.  ..|...|...|.:..:   ....|:||.:.. :.|.. 
  Fly    45 SVGDSVEFNCTVEEVGQLSVSWAKR--PSESDTNSVVLSMRNI---LSLPDQRYNVTVTEGPKTG 104

  Fly   345 ---WRLKITNVKKDDEAIYECQISTHPPRVI--QINLHV--------NAPKVMIVDEVGDPLQEK 396
               :..:|.|::..|...||||:.......:  :::|.:        |.||..:|.|        
  Fly   105 SAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTE-------- 161

  Fly   397 YYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
                ...|:|:|...  ......:.|....|.:   :..||     .|:   |..||.|..:.:.
  Fly   162 ----GQNLELTCHAN--GFPKPTISWAREHNAV---MPAGG-----HLL---AEPTLRIRSVHRM 209

  Fly   462 DSGNYTC 468
            |.|.|.|
  Fly   210 DRGGYYC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/91 (23%)
Ig 279..378 CDD:299845 22/105 (21%)
Ig 400..471 CDD:299845 16/69 (23%)
IG_like 402..480 CDD:214653 16/67 (24%)
AmaNP_731114.2 I-set 33..143 CDD:254352 24/143 (17%)
Ig 37..127 CDD:299845 21/123 (17%)
IG_like 154..234 CDD:214653 20/88 (23%)
IGc2 161..223 CDD:197706 17/81 (21%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.