DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and LSAMP

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:199 Identity:47/199 - (23%)
Similarity:78/199 - (39%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
            |:||:.|.:..|.|   :::||.  |:|:            |...::..|...::.|.|.::|.:
Human    40 NITVRQGDTAILRC---VVEDKNSKVAWL------------NRSGIIFAGHDKWSLDPRVELEKR 89

  Fly   341 YPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNA-PKVMIVDEVGDPLQEKYYEIDST 403
            :...:.|:|..|...||..|.|.:.| |.|:..|:.|.|.. ||:..:..            |.|
Human    90 HSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS------------DVT 142

  Fly   404 LQLSCVVRNVAMTSS----VVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSG 464
            :.....|..|.|.:.    |:.|:|:              ..|....:|....|.|..|::..||
Human   143 VNEGSNVTLVCMANGRPEPVITWRHL--------------TPTGREFEGEEEYLEILGITREQSG 193

  Fly   465 NYTC 468
            .|.|
Human   194 KYEC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 22/88 (25%)
Ig 279..378 CDD:299845 26/101 (26%)
Ig 400..471 CDD:299845 17/73 (23%)
IG_like 402..480 CDD:214653 16/71 (23%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 27/102 (26%)
Ig 132..215 CDD:386229 19/92 (21%)
Ig_3 219..294 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.