Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305844.1 | Gene: | LSAMP / 4045 | HGNCID: | 6705 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 78/199 - (39%) | Gaps: | 49/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
Fly 341 YPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNA-PKVMIVDEVGDPLQEKYYEIDST 403
Fly 404 LQLSCVVRNVAMTSS----VVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSG 464
Fly 465 NYTC 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 22/88 (25%) |
Ig | 279..378 | CDD:299845 | 26/101 (26%) | ||
Ig | 400..471 | CDD:299845 | 17/73 (23%) | ||
IG_like | 402..480 | CDD:214653 | 16/71 (23%) | ||
LSAMP | NP_001305844.1 | Ig | 38..128 | CDD:386229 | 27/102 (26%) |
Ig | 132..215 | CDD:386229 | 19/92 (21%) | ||
Ig_3 | 219..294 | CDD:372822 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |