DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and CG7166

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:91/269 - (33%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNW 345
            |..|.:|.|.|::..|....:.|.:.::            :||.|....|.|:|:|:...|    
  Fly    50 VIVGETIELPCKVQNLGSFVLLWRKGSS------------VLTAGHLKITRDQRFKIVGDY---- 98

  Fly   346 RLKITNVKKDDEAIYECQISTH-------------PP--RVIQINLHVNAPKVMIVDEVGDPLQE 395
            .|:|..||..|...|.||:...             ||  |.:..|..|.|.|             
  Fly    99 NLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARK------------- 150

  Fly   396 KYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISK 460
                 .||:.|.|......:.:  :||      ...||..|    .|.|.:   :|||.:..:.:
  Fly   151 -----GSTVTLECKASGNPVPT--IFW------FKKDVFSG----PTHLSD---SSTLILENVDR 195

  Fly   461 TDSGNYTCS--------ISEFQNFTIV-----------VHILNG---ESFAELHHGGAVGWHSTW 503
            ..:|.|.||        :|.....||:           ||...|   |....:|  |.|.....|
  Fly   196 HHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVH--GDVNSEMLW 258

  Fly   504 W-NMVMLHA 511
            : |..:|.|
  Fly   259 YQNSFLLDA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 23/83 (28%)
Ig 279..378 CDD:299845 27/111 (24%)
Ig 400..471 CDD:299845 18/78 (23%)
IG_like 402..480 CDD:214653 21/96 (22%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/98 (23%)
Ig 56..116 CDD:143165 19/75 (25%)
IG_like 144..221 CDD:214653 22/109 (20%)
IGc2 151..209 CDD:197706 18/72 (25%)
IG_like 232..313 CDD:214653 11/38 (29%)
Ig 242..311 CDD:143165 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.