DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and CG7166

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_649339.2 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:91/269 - (33%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNW 345
            |..|.:|.|.|::..|....:.|.:.::            :||.|....|.|:|:|:...|    
  Fly    50 VIVGETIELPCKVQNLGSFVLLWRKGSS------------VLTAGHLKITRDQRFKIVGDY---- 98

  Fly   346 RLKITNVKKDDEAIYECQISTH-------------PP--RVIQINLHVNAPKVMIVDEVGDPLQE 395
            .|:|..||..|...|.||:...             ||  |.:..|..|.|.|             
  Fly    99 NLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARK------------- 150

  Fly   396 KYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISK 460
                 .||:.|.|......:.:  :||      ...||..|    .|.|.:   :|||.:..:.:
  Fly   151 -----GSTVTLECKASGNPVPT--IFW------FKKDVFSG----PTHLSD---SSTLILENVDR 195

  Fly   461 TDSGNYTCS--------ISEFQNFTIV-----------VHILNG---ESFAELHHGGAVGWHSTW 503
            ..:|.|.||        :|.....||:           ||...|   |....:|  |.|.....|
  Fly   196 HHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVH--GDVNSEMLW 258

  Fly   504 W-NMVMLHA 511
            : |..:|.|
  Fly   259 YQNSFLLDA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 23/99 (23%)
IG_like 278..365 CDD:214653 23/83 (28%)
Ig strand B 287..291 CDD:409382 2/3 (67%)
Ig strand C 300..304 CDD:409382 0/3 (0%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 21/96 (22%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 3/3 (100%)
CG7166NP_649339.2 IG_like 50..133 CDD:214653 23/98 (23%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 98..102 CDD:409353 2/7 (29%)
Ig strand F 112..116 CDD:409353 1/3 (33%)
Ig_3 134..207 CDD:464046 25/105 (24%)
Ig_3 224..301 CDD:464046 11/46 (24%)

Return to query results.
Submit another query.