DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and IGLON5

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:321 Identity:71/321 - (22%)
Similarity:109/321 - (33%) Gaps:113/321 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 ATNLTVQAGSSIHLNCRISLLQDK---TVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKM 337
            |.|.||..|.:..|:|.|    |:   .|:|:            |..::|..|...:|.|.|.::
Human    39 ADNYTVCEGDNATLSCFI----DEHVTRVAWL------------NRSNILYAGNDRWTSDPRVRL 87

  Fly   338 EFQYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNAPKVMI-------VDE------ 388
            ....|..:.:.||.|...||.:|.|...| |.|...|:.|.|:.|..::       |:|      
Human    88 LINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVTVNEGGNVNL 152

  Fly   389 ----VGDP--------LQEKYYEIDSTLQLS-----------CVVRN------------------ 412
                ||.|        |::.:......|::|           ||..|                  
Human   153 LCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYP 217

  Fly   413 -----------------------VAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLS 454
                                   :|:..:...|...|.:|: ..|..|:.|:||    ...|.|.
Human   218 PTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLS-SGTAEGLKVQTE----RTRSMLL 277

  Fly   455 IAKISKTDSGNYTC-SISEFQNFTIVVHILNG---ESFAELHHG-----GAVGWHSTWWNM 506
            .|.:|....||||| :.:.....:..:.:|..   |:.|....|     .|:||  .||.|
Human   278 FANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGLLALLSALGW--LWWRM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 26/95 (27%)
IG_like 278..365 CDD:214653 24/89 (27%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 0/3 (0%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 23/130 (18%)
Ig strand B 404..408 CDD:409353 2/14 (14%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
IGLON5NP_001094842.1 Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 10/64 (16%)
Ig_3 217..295 CDD:464046 18/82 (22%)
Ig 41..129 CDD:472250 29/103 (28%)
Ig strand B 50..54 CDD:409382 1/3 (33%)
Ig strand C 62..66 CDD:409382 1/3 (33%)
Ig strand E 95..99 CDD:409382 0/3 (0%)
Ig strand F 109..114 CDD:409382 2/4 (50%)

Return to query results.
Submit another query.