DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Dscam2

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:494 Identity:100/494 - (20%)
Similarity:165/494 - (33%) Gaps:196/494 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TAHAHIHNQVSTLRSSYEDSDDGVDGDYV-IPESQTSTV--------------AILDQDSSMKGQ 142
            |.|..:   :|.:..|:...:||  |:|. |.|::...|              .::.:.:::.| 
  Fly   476 TVHGDV---ISHVNISHVMVEDG--GEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSG- 534

  Fly   143 DMESLSLQA------------------------------GSGTVSPKSSPDSSG-------HKKN 170
              |:|:|:.                              ||.|:||......||       :|:.
  Fly   535 --ETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQG 597

  Fly   171 ASFQQIGSQNVNALVP--------------------ATVATTSSGLPSSSN-ASLATPTEPARNR 214
            .|.::.|  .|..:||                    .|.:.....||.:.| .....|.:|.::.
  Fly   598 HSARRSG--EVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHM 660

  Fly   215 S--------------------TG----LVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANK 255
            |                    ||    :|||||.:|::...|         ::|           
  Fly   661 SVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQAL---------LVN----------- 705

  Fly   256 HHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALD 320
                   ..|.:     |.:..:..|:....|.|:|:...:...::.|.:               
  Fly   706 -------VPPRW-----IVEPVDANVERNRHIMLHCQAQGVPTPSIVWKK--------------- 743

  Fly   321 LLTVGMHTYTGDK--RYKMEFQYP-----NNWRLKITNVKKDDEAIYECQ----ISTHPPRVIQI 374
                    .||.|  .|:...:.|     .|..|.:.:||:|.|..|.||    |.|...:|||:
  Fly   744 --------ATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQL 800

  Fly   375 NLHVNAP-------KVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYD 432
            .:: ::|       .||:  :.||           |..|.|.|.. ....::|:.:...|.|| .
  Fly   801 KVN-SSPYFSSTSRSVMV--KKGD-----------TALLQCAVSG-DKPINIVWMRSGKNTLN-P 849

  Fly   433 VTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSIS 471
            .|...:|||.|...||.::.|.|..:..||||.|.|..|
  Fly   850 STNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRAS 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 19/97 (20%)
Ig 279..378 CDD:299845 24/109 (22%)
Ig 400..471 CDD:299845 23/70 (33%)
IG_like 402..480 CDD:214653 24/70 (34%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 11/45 (24%)
IGc2 436..507 CDD:197706 10/35 (29%)
I-set 521..610 CDD:254352 15/93 (16%)
IGc2 533..597 CDD:197706 12/66 (18%)
Ig 630..699 CDD:143165 15/68 (22%)
IG_like 714..802 CDD:214653 24/110 (22%)
Ig 725..802 CDD:299845 23/99 (23%)
Ig 823..894 CDD:143165 23/68 (34%)
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.