DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and babos

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:206 Identity:48/206 - (23%)
Similarity:79/206 - (38%) Gaps:28/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 DLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIY--ECQISTHPPRVIQINLHVNAPK 382
            |||..|:....|....   ..||.: .:....::.||:..|  |.|.:..|        ...:|.
  Fly     6 DLLIAGLLLIVGSAAV---ISYPQS-SMDDDQMQADDDFDYGGEDQSAPSP--------QTKSPN 58

  Fly   383 VMIVDEVGDPLQEKYYEIDSTLQLSC-VVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELME 446
            .:..:::...|.......:..: |.| |..|:..:..||.|...||:    ::.|...|:.....
  Fly    59 PVASEKINKTLSVTGIRGEDVV-LKCDVGSNLHSSDVVVLWYFGDNV----ISNGKNLVQPNFKL 118

  Fly   447 DGANSTLSIAKISKTDSGNYTCSISEF-----QNFTIVVHILNGESFAELHHGGAVGWHSTWWNM 506
            | ||..|:|.|.|...:|:|.|.:...     ...||..|.|  ::.|......|.|..|::...
  Fly   119 D-ANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSL--DAIAPESSTSAAGSASSFLGC 180

  Fly   507 VMLHAMALLVL 517
            .:|.:..||:|
  Fly   181 TVLASTVLLLL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 12/46 (26%)
Ig 279..378 CDD:299845 13/59 (22%)
Ig 400..471 CDD:299845 21/71 (30%)
IG_like 402..480 CDD:214653 23/83 (28%)
babosNP_001286719.1 ig 70..154 CDD:278476 21/89 (24%)
IG_like 70..154 CDD:214653 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.