DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Cadm4

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001040572.1 Gene:Cadm4 / 365216 RGDID:1304722 Length:388 Species:Rattus norvegicus


Alignment Length:208 Identity:49/208 - (23%)
Similarity:91/208 - (43%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 QATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNG-NALDLLTVGMHTYTGDKRYKME 338
            |..|:||..|....:.||:. ..|.::..:::..:.....|| .||.           |:|:::|
  Rat    28 QTENVTVAEGGVAEITCRLH-QYDGSIVVIQNPARQTLFFNGTRALK-----------DERFQLE 80

  Fly   339 FQYPNNWRLKITNVKKDDEAIYECQISTHPP--RVIQINLHVNAPKVMIVDEVGDPLQEKYYEID 401
            ...|...|:::::.:.:||..|.||:.|...  ::..:.:.| ||:..:|:     ::|:..| .
  Rat    81 EFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLV-APENPVVE-----VREQAVE-G 138

  Fly   402 STLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDG----ANSTLSIAKISKTD 462
            ..::|||:|.. :..::|:.| :.|......|:.|        .|:|    ..||:......|.|
  Rat   139 GEVELSCLVPR-SRPAAVLRW-YRDRKELKGVSSG--------QENGKVWSVASTVRFRVDRKDD 193

  Fly   463 SGNYTCSISEFQN 475
            .|...|   |.||
  Rat   194 GGIVIC---EAQN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 23/93 (25%)
IG_like 278..365 CDD:214653 21/87 (24%)
Ig strand B 287..291 CDD:409382 0/3 (0%)
Ig strand C 300..304 CDD:409382 0/3 (0%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 20/78 (26%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
Cadm4NP_001040572.1 Ig 29..120 CDD:472250 22/102 (22%)
Ig strand B 40..44 CDD:409465 0/3 (0%)
Ig strand C 53..57 CDD:409465 0/3 (0%)
Ig strand E 87..91 CDD:409465 1/3 (33%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 26/103 (25%)
Ig strand A 121..124 CDD:409468 1/3 (33%)
Ig strand A' 127..131 CDD:409468 1/8 (13%)
Ig strand B 139..149 CDD:409468 4/9 (44%)
Ig strand C 152..161 CDD:409468 2/9 (22%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 2/14 (14%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/10 (30%)
Ig strand G 212..219 CDD:409468
Ig_3 224..295 CDD:464046
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.