DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr19

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:309 Identity:81/309 - (26%)
Similarity:125/309 - (40%) Gaps:80/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGK 313
            |||...|.......:|...:........|.:..|.|....|.|.:.:....||||:|.      |
  Fly    20 TFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRR------K 78

  Fly   314 DNGNALDLLTVGMHTYTGDKRYKMEF-QYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLH 377
            |    ..|||||:.|::.|||:.:|. ::..:|.|:|..|:::|...||||:|.:|.:.|.|.|.
  Fly    79 D----FQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELK 139

  Fly   378 VNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSV-- 440
            :    |..|.|:.. ..|.:.:..|||:|.|.::......:.|||.|...::||| ::||..|  
  Fly   140 I----VEAVAEISS-APELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYD-SQGGFVVTS 198

  Fly   441 ---------------------KTELMED------------------GAN---------------- 450
                                 .|..||.                  .||                
  Fly   199 IGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAY 263

  Fly   451 ------STLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHH 493
                  |.|::.:::...:|||||:.|..:..:|.||:|.||..|.:.|
  Fly   264 LLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 30/87 (34%)
Ig 279..378 CDD:299845 35/99 (35%)
Ig 400..471 CDD:299845 27/133 (20%)
IG_like 402..480 CDD:214653 29/140 (21%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 30/86 (35%)
IGc2 55..125 CDD:197706 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.