DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-iota

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:97/244 - (39%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGK 313
            :||..|..       .|.|.     |...|.||..|....|.|.:..|....|:|:|.:||    
  Fly    22 SFSELNNS-------DPKFS-----GPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQ---- 70

  Fly   314 DNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHV 378
                  .:|::..|..|.:.|..:.......|:|||.:|::.|...|.|||:|.|.:.....|.|
  Fly    71 ------TILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDV 129

  Fly   379 NAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDN---ILNYDVTRGGVSV 440
            ..|..::..:..   |:........:.|:|....|.|.:  :.|:..:.   :::.|..|...||
  Fly   130 VVPPDIVDYQTS---QDVVRSTGQNVTLTCSATGVPMPT--ITWRREEATPILISDDGDREVFSV 189

  Fly   441 KTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFA 489
                  :|.|  |::.::.::..|.|.|..|.....|:...::...:||
  Fly   190 ------EGQN--LTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 33/118 (28%)
IG_like 278..365 CDD:214653 25/86 (29%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 17/80 (21%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/95 (29%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 18/106 (17%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 0/5 (0%)
Ig strand E 192..196 CDD:409562 2/5 (40%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046 57/244 (23%)

Return to query results.
Submit another query.