DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-iota

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:97/244 - (39%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGK 313
            :||..|..       .|.|.     |...|.||..|....|.|.:..|....|:|:|.:||    
  Fly    22 SFSELNNS-------DPKFS-----GPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQ---- 70

  Fly   314 DNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHV 378
                  .:|::..|..|.:.|..:.......|:|||.:|::.|...|.|||:|.|.:.....|.|
  Fly    71 ------TILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDV 129

  Fly   379 NAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDN---ILNYDVTRGGVSV 440
            ..|..::..:..   |:........:.|:|....|.|.:  :.|:..:.   :::.|..|...||
  Fly   130 VVPPDIVDYQTS---QDVVRSTGQNVTLTCSATGVPMPT--ITWRREEATPILISDDGDREVFSV 189

  Fly   441 KTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFA 489
                  :|.|  |::.::.::..|.|.|..|.....|:...::...:||
  Fly   190 ------EGQN--LTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 25/86 (29%)
Ig 279..378 CDD:299845 28/98 (29%)
Ig 400..471 CDD:299845 15/73 (21%)
IG_like 402..480 CDD:214653 17/80 (21%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/95 (29%)
Ig 39..122 CDD:299845 28/92 (30%)
Ig 132..213 CDD:299845 17/93 (18%)
IG_like 141..227 CDD:214653 18/98 (18%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.