DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-theta

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:369 Identity:79/369 - (21%)
Similarity:138/369 - (37%) Gaps:87/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LQAGSGTVSPKSSPDSSGHK--KNASFQQIGSQNVNALVPATVATTSSGLPSSSNASLATPTEPA 211
            |.|.:.|::.:.....:..|  :.....:|.|:.:       |||.::.:.|....|||.|...|
  Fly     8 LTADAATIAARRQRRRAAGKLQRKREMPEISSRLI-------VATATAAVVSIICLSLALPGCAA 65

  Fly   212 R----------------NRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHD 260
            :                .....::..|.......|.|::.|..|..:.:...||..:|...    
  Fly    66 QESDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAIPE---- 126

  Fly   261 QRYGPHFEDVQRIGQ-ATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTV 324
                   :|:.:.|: ..|:||.......|.|.:..||...::|:|.:||          .:||:
  Fly   127 -------KDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQ----------TILTI 174

  Fly   325 GMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEV 389
            ..|..|.:.|..:.......|.|:|.:||:.|:..|.|||:|.|     :...|....|::..::
  Fly   175 QNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDP-----MKSQVGYLDVVVPPDI 234

  Fly   390 GD-PLQ-EKYYEIDSTLQLSCVVRNVAMTSS---VVFWKHMDNILNYDVTRGGVSVKTELMEDGA 449
            .| |.. :......|.:.|.|     |.|.|   .:.|:.          .||..:.   :.:||
  Fly   235 LDYPTSTDMVIREGSNVTLKC-----AATGSPTPTITWRR----------EGGELIP---LPNGA 281

  Fly   450 ------NSTLSIAKISKTDSGNYTCSISE------FQNFTIVVH 481
                  .|.|:|||:::.:.|.|.|..|.      .:...::||
  Fly   282 EAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 25/86 (29%)
Ig 279..378 CDD:299845 27/98 (28%)
Ig 400..471 CDD:299845 19/79 (24%)
IG_like 402..480 CDD:214653 20/92 (22%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 30/107 (28%)
IG_like 137..230 CDD:214653 30/107 (28%)
IG_like 240..324 CDD:214653 20/101 (20%)
IGc2 247..310 CDD:197706 19/80 (24%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.