DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-eta

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:227 Identity:53/227 - (23%)
Similarity:85/227 - (37%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP 342
            |:|...|....|.|.:..|....|:|:|.:||          .:||:..|..|.::|..:.....
  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQ----------TILTIQNHVITKNQRIGIANSEH 105

  Fly   343 NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAP---------KVMIVDEVGDPLQEKYY 398
            ..|.::|.::|:.|:..|.|||:|.|.:.....|.|..|         ..|:|.|          
  Fly   106 KTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVRE---------- 160

  Fly   399 EIDSTLQLSCVVRNVAMTSS---VVFWKHMDNILNYDVTRGGVSVKTELMEDGAN---STLSIAK 457
              .|.:.|.|     |.|.|   .:.|:.          ..||.::....|:..:   :.|.|..
  Fly   161 --GSNVTLKC-----AATGSPEPTITWRR----------ESGVPIELATGEEVMSIEGTDLVIPN 208

  Fly   458 ISKTDSGNYTC--------SISEFQNFTIVVH 481
            :.:...|.|.|        |:|  :..|:|||
  Fly   209 VRRHHMGAYLCIASNGVPPSVS--KRITLVVH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 23/86 (27%)
Ig 279..378 CDD:299845 26/98 (27%)
Ig 400..471 CDD:299845 16/84 (19%)
IG_like 402..480 CDD:214653 18/91 (20%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 27/99 (27%)
IG_like 51..137 CDD:214653 26/95 (27%)
IG_like 153..237 CDD:214653 21/112 (19%)
Ig 161..224 CDD:299845 15/77 (19%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.