DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-eta

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:227 Identity:53/227 - (23%)
Similarity:85/227 - (37%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP 342
            |:|...|....|.|.:..|....|:|:|.:||          .:||:..|..|.::|..:.....
  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQ----------TILTIQNHVITKNQRIGIANSEH 105

  Fly   343 NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAP---------KVMIVDEVGDPLQEKYY 398
            ..|.::|.::|:.|:..|.|||:|.|.:.....|.|..|         ..|:|.|          
  Fly   106 KTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVRE---------- 160

  Fly   399 EIDSTLQLSCVVRNVAMTSS---VVFWKHMDNILNYDVTRGGVSVKTELMEDGAN---STLSIAK 457
              .|.:.|.|     |.|.|   .:.|:.          ..||.::....|:..:   :.|.|..
  Fly   161 --GSNVTLKC-----AATGSPEPTITWRR----------ESGVPIELATGEEVMSIEGTDLVIPN 208

  Fly   458 ISKTDSGNYTC--------SISEFQNFTIVVH 481
            :.:...|.|.|        |:|  :..|:|||
  Fly   209 VRRHHMGAYLCIASNGVPPSVS--KRITLVVH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 25/89 (28%)
IG_like 278..365 CDD:214653 23/86 (27%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 18/91 (20%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/8 (13%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 26/95 (27%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
IgI_1_MuSK 145..237 CDD:409562 21/120 (18%)
Ig strand A 145..148 CDD:409562 0/2 (0%)
Ig strand A' 153..158 CDD:409562 1/4 (25%)
Ig strand B 164..171 CDD:409562 3/11 (27%)
Ig strand C 177..182 CDD:409562 1/4 (25%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 1/2 (50%)
Ig strand E 202..208 CDD:409562 2/5 (40%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 2/9 (22%)
IG_like 252..335 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 271..282 CDD:409353
Ig strand E 301..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.