DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and fipi

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:268 Identity:52/268 - (19%)
Similarity:92/268 - (34%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 QKTDAPMLNYIFDTFSSANKHHH---------HDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLN 290
            ::|....|..:|...:.|:|.:.         |.:.:. ..::.:.....||.:||:.|....:.
  Fly    75 EQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATIL 139

  Fly   291 CRISLLQDKTVSWVRHNTQ--DEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVK 353
            |.:.......|:| ..|.|  ..|..:.:...:|..|                     |.|..|.
  Fly   140 CEVKGEPQPNVTW-HFNGQPISAGAADDSKFRILADG---------------------LLINKVT 182

  Fly   354 KDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSS 418
            ::|...|.|       |..|:|            .:...:||:      |:.:.  :.:..:.|.
  Fly   183 QNDTGEYAC-------RAYQVN------------SIASDMQER------TVLMK--IEHKPIWSK 220

  Fly   419 VVFWKHMDNILNYDVTRGGVSVKTE-LMEDGANSTLSIAKISKTDSGN--YTCSISEFQNFTIVV 480
            ..|..     |.|....|..::..| |.|..||.|. ..|.:|..|.|  ||.....:.: ::.:
  Fly   221 TPFVS-----LKYAYINGTATLMCEALAEPPANFTW-YRKHNKLHSNNRLYTIQSDSYWS-SLTI 278

  Fly   481 HILNGESF 488
            |:||..:|
  Fly   279 HVLNTSAF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/88 (19%)
Ig 279..378 CDD:299845 20/100 (20%)
Ig 400..471 CDD:299845 18/73 (25%)
IG_like 402..480 CDD:214653 18/80 (23%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 6/39 (15%)
I-set 128..202 CDD:254352 20/114 (18%)
Ig 133..>193 CDD:299845 15/88 (17%)
IG_like 228..307 CDD:214653 18/61 (30%)
Ig 235..305 CDD:143165 16/54 (30%)
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.