DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and CG33543

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:341 Identity:62/341 - (18%)
Similarity:114/341 - (33%) Gaps:86/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 NALVPATVATTSSGLPSSSNASLATP------TEPARNRSTGLVRNSAV--------KVDSKHPL 232
            ||.:...:.:||||...:..|....|      .:|:....|..|..|.:        .:|:|...
  Fly    18 NAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRD 82

  Fly   233 SKGQ------------KTDAPMLNYIFDTFS---------------SANKHHHHDQRYGPHFEDV 270
            .:||            |....:|..:|:..:               :.|::.:.::.:...||.:
  Fly    83 PRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELL 147

  Fly   271 --QRI--GQATNL-TVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYT 330
              |:|  |:...: :|:.|....:||.:..:....|||:.         ||..::.:....|...
  Fly   148 VNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLY---------NGEYINTVNSTKHNRL 203

  Fly   331 GDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRV-----IQINLHVNAPKVMIVDEVG 390
            .:..|             |.||.:.|...|.|:.....|..     |.|.|.:........:|. 
  Fly   204 SNGLY-------------IRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNET- 254

  Fly   391 DPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSI 455
              |..:|..:...:.|||........|..  |.|.:        :|.|.....:......:||.:
  Fly   255 --LPVQYAYVGGAVNLSCDAMGEPPPSFT--WLHNN--------KGIVGFNHRIFVADYGATLQL 307

  Fly   456 AKISKTDSGNYTCSIS 471
            ...:.:..|:|.|.::
  Fly   308 QMKNASQFGDYKCKVA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/87 (20%)
Ig 279..378 CDD:299845 21/104 (20%)
Ig 400..471 CDD:299845 13/70 (19%)
IG_like 402..480 CDD:214653 13/70 (19%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/80 (20%)
IG_like 256..336 CDD:214653 14/78 (18%)
IGc2 263..327 CDD:197706 13/71 (18%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.