DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr4

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:283 Identity:83/283 - (29%)
Similarity:136/283 - (48%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HHHDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALD 320
            |:.:..|. |:|::..|    ..:|...|.:..|:||:..|.|:.|||:|...          |.
  Fly    36 HYWETPYSQPYFDNSSR----REVTATVGQAALLHCRVRNLGDRAVSWIRKRD----------LH 86

  Fly   321 LLTVGMHTYTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYECQISTHP--PRVIQINLHVNAPK 382
            :||||:.|||.|:|:: :..:..:.|.|:|::.:..|...||||:||.|  .:..::|:.|:..|
  Fly    87 ILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAK 151

  Fly   383 VMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMED 447
            ::     |:  .|.:.:..|.:.|:|:.....:..|.::|.....::||. .|||::|.||  ..
  Fly   152 IL-----GN--AELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYS-QRGGINVITE--RS 206

  Fly   448 GANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHG------------------ 494
            ...|.|.|||.:..||||||||.|...:.::|||::|||..|.:.||                  
  Fly   207 TRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFV 271

  Fly   495 ---------GAVGWHSTW---WN 505
                     .:|.|:|..   ||
  Fly   272 LATWMSMTVASVAWNSNLNINWN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 36/112 (32%)
IG_like 278..365 CDD:214653 29/87 (33%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 2/3 (67%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 3/4 (75%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 27/77 (35%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 32/101 (32%)
Ig strand A' 55..57 CDD:409355 0/1 (0%)
Ig strand B 61..69 CDD:409355 2/7 (29%)
CDR1 69..75 CDD:409355 1/5 (20%)
Ig strand C 76..82 CDD:409355 3/5 (60%)
CDR2 85..101 CDD:409355 9/15 (60%)
Ig strand D 101..106 CDD:409355 0/4 (0%)
FR3 102..131 CDD:409355 7/28 (25%)
Ig strand E 110..117 CDD:409355 2/6 (33%)
Ig strand F 125..132 CDD:409355 4/6 (67%)
IG_like 161..>227 CDD:214653 23/68 (34%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 0/3 (0%)
Ig strand E 206..214 CDD:409353 2/7 (29%)

Return to query results.
Submit another query.