DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr8

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:260 Identity:93/260 - (35%)
Similarity:136/260 - (52%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHT 328
            ||.|:..  ||  ||:|...|.::.|.||:..|.::|||||||..          :.|||||.:|
  Fly    41 GPTFDTT--IG--TNITGLVGKTVKLTCRVKNLGNRTVSWVRHRD----------IHLLTVGRYT 91

  Fly   329 YTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDP 392
            ||.|:|:: |...:..:|.|:|...::.|..||||||||.||....:.|::..|   :.|.:|.|
  Fly    92 YTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEP---VTDIIGGP 153

  Fly   393 LQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDG--ANSTLSI 455
              |.:....||:.|:|:|:........|.|.|...|:|:|..|||:|:.|   |.|  ..|.|.:
  Fly   154 --ELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVT---EKGVLTTSRLLV 213

  Fly   456 AKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVLNSL 520
            .|....|||.|||:.|.....::.|||::||..|.:|.|.  ..:||.....:|..:.||..::|
  Fly   214 QKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGN--NGNSTASQPPVLLPLVLLTCSTL 276

  Fly   521  520
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 34/87 (39%)
Ig 279..378 CDD:299845 39/99 (39%)
Ig 400..471 CDD:299845 27/72 (38%)
IG_like 402..480 CDD:214653 28/79 (35%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 36/89 (40%)
V-set 52..143 CDD:284989 39/100 (39%)
IG_like 153..238 CDD:214653 30/89 (34%)
ig 153..232 CDD:278476 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.