DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr8

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:260 Identity:93/260 - (35%)
Similarity:136/260 - (52%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHT 328
            ||.|:..  ||  ||:|...|.::.|.||:..|.::|||||||..          :.|||||.:|
  Fly    41 GPTFDTT--IG--TNITGLVGKTVKLTCRVKNLGNRTVSWVRHRD----------IHLLTVGRYT 91

  Fly   329 YTGDKRYK-MEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDP 392
            ||.|:|:: |...:..:|.|:|...::.|..||||||||.||....:.|::..|   :.|.:|.|
  Fly    92 YTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEP---VTDIIGGP 153

  Fly   393 LQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDG--ANSTLSI 455
              |.:....||:.|:|:|:........|.|.|...|:|:|..|||:|:.|   |.|  ..|.|.:
  Fly   154 --ELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVT---EKGVLTTSRLLV 213

  Fly   456 AKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVLNSL 520
            .|....|||.|||:.|.....::.|||::||..|.:|.|.  ..:||.....:|..:.||..::|
  Fly   214 QKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGN--NGNSTASQPPVLLPLVLLTCSTL 276

  Fly   521  520
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 43/104 (41%)
IG_like 278..365 CDD:214653 34/87 (39%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 3/3 (100%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 4/4 (100%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 28/79 (35%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
dpr8NP_727781.1 IG_like 51..131 CDD:214653 36/89 (40%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 3/3 (100%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 4/4 (100%)
Ig_3 153..230 CDD:464046 29/81 (36%)

Return to query results.
Submit another query.