| Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 210 | Identity: | 46/210 - (21%) |
|---|---|---|---|
| Similarity: | 80/210 - (38%) | Gaps: | 56/210 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 278 NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNG---NALDLLTVGMHTYTGDKRYKMEF 339
Fly 340 QYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDST 403
Fly 404 LQLSCVVRNVAMT-------SSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
Fly 462 DSGNYTCSISEFQNF 476 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 18/89 (20%) |
| Ig | 279..378 | CDD:299845 | 23/102 (23%) | ||
| Ig | 400..471 | CDD:299845 | 17/77 (22%) | ||
| IG_like | 402..480 | CDD:214653 | 17/82 (21%) | ||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 4/13 (31%) |
| Ig strand A' | 40..46 | CDD:409353 | 2/4 (50%) | ||
| IG_like | 41..129 | CDD:214653 | 24/103 (23%) | ||
| Ig strand B | 48..56 | CDD:409353 | 2/7 (29%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/19 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 9/34 (26%) | ||
| Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 2/7 (29%) | ||
| CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
| Ig strand G | 120..129 | CDD:409353 | 4/8 (50%) | ||
| FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 16/72 (22%) | ||
| Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 180..186 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 193..200 | CDD:409353 | 4/6 (67%) | ||
| Ig_3 | 219..295 | CDD:404760 | |||
| putative Ig strand A | 219..225 | CDD:409353 | |||
| Ig strand B | 235..239 | CDD:409353 | |||
| Ig strand C | 248..252 | CDD:409353 | |||
| Ig strand E | 274..278 | CDD:409353 | |||
| Ig strand F | 288..293 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||