DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:236 Identity:57/236 - (24%)
Similarity:92/236 - (38%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 TDAPMLNYIFDTFSSANKHHHHD-QRYGPHFEDVQRIGQ-ATNLTVQAGSSIHLNCRISLLQDKT 300
            |..|.|..|    .|..||...| |:......|..|..: ..|:||..|....:.|.:..|:...
  Fly    44 TATPTLAEI----PSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYK 104

  Fly   301 VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQIS 365
            |:|||.:||          .:|::..:..:.:.|..:.:....:|.|.|..|::.|...|.||::
  Fly   105 VAWVRVDTQ----------TILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVN 159

  Fly   366 THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILN 430
            |.|.|..:..|.|..|.:::     :.|......:.....:|.|.:........|.|:..|   .
  Fly   160 TDPMRSRKGYLQVVVPPIIV-----EGLTSNDMVVREGQNISLVCKARGYPEPYVMWRRED---G 216

  Fly   431 YDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSIS 471
            .::..||..|.   :.||  ..|.|.|:|:.....|.|..|
  Fly   217 EEMLIGGEHVN---VVDG--ELLHITKVSRLHMAAYLCVAS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 34/131 (26%)
IG_like 278..365 CDD:214653 22/86 (26%)
Ig strand B 287..291 CDD:409382 0/3 (0%)
Ig strand C 300..304 CDD:409382 1/3 (33%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 17/70 (24%)
Ig strand B 404..408 CDD:409353 0/3 (0%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 27/101 (27%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 18/90 (20%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.