DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:236 Identity:57/236 - (24%)
Similarity:92/236 - (38%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 TDAPMLNYIFDTFSSANKHHHHD-QRYGPHFEDVQRIGQ-ATNLTVQAGSSIHLNCRISLLQDKT 300
            |..|.|..|    .|..||...| |:......|..|..: ..|:||..|....:.|.:..|:...
  Fly    44 TATPTLAEI----PSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYK 104

  Fly   301 VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQIS 365
            |:|||.:||          .:|::..:..:.:.|..:.:....:|.|.|..|::.|...|.||::
  Fly   105 VAWVRVDTQ----------TILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVN 159

  Fly   366 THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILN 430
            |.|.|..:..|.|..|.:::     :.|......:.....:|.|.:........|.|:..|   .
  Fly   160 TDPMRSRKGYLQVVVPPIIV-----EGLTSNDMVVREGQNISLVCKARGYPEPYVMWRRED---G 216

  Fly   431 YDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSIS 471
            .::..||..|.   :.||  ..|.|.|:|:.....|.|..|
  Fly   217 EEMLIGGEHVN---VVDG--ELLHITKVSRLHMAAYLCVAS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 22/86 (26%)
Ig 279..378 CDD:299845 25/98 (26%)
Ig 400..471 CDD:299845 16/70 (23%)
IG_like 402..480 CDD:214653 17/70 (24%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 26/101 (26%)
IG_like 82..174 CDD:214653 27/101 (27%)
IG_like 184..267 CDD:214653 17/77 (22%)
IGc2 191..255 CDD:197706 17/70 (24%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.