DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and rst

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:605 Identity:108/605 - (17%)
Similarity:183/605 - (30%) Gaps:231/605 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLLIATIMGSGLVQAKTIYDSVNMIQSLDALVEPRETTKVPLQTTPATPPTAHAHIHNQVSTLRS 107
            |||:|||:|.......|.|      |:....:||::.|.|     .....|....:.|:..||:.
  Fly     7 LLLLATIVGMVRSSPYTSY------QNQRFAMEPQDQTAV-----VGARVTLPCRVINKQGTLQW 60

  Fly   108 SYED-------------------SDDGVDGDYVI--------------------PESQ---TSTV 130
            :.:|                   ||:  :|||.:                    ||.|   .||.
  Fly    61 TKDDFGLGTSRDLSGFERYAMVGSDE--EGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTF 123

  Fly   131 AIL-------------------DQDS-------SMKGQDMESLSLQAGSG---------TVSP-- 158
            |.|                   .:|.       |:.|:....::...|.|         ||.|  
  Fly   124 AGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLP 188

  Fly   159 -----------KSSPDSSGHKKNASFQQIGSQNV------NALV-------PATVATTSSGLPSS 199
                       :.:|....|..|.|.|   :||.      :|.:       |.........||..
  Fly   189 DQRRFTAKSVLRLTPKKEHHNTNFSCQ---AQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGG 250

  Fly   200 SNASLATPTEPARNRSTG--LVRNSAVKVDSK----------------HPLSKGQKTDAPMLNY- 245
            :..|:......:.:.|||  :|.:|.|:::.:                .|:..||||:..:.|. 
  Fly   251 AGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVT 315

  Fly   246 -----------IFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDK 299
                       :.::...:......|..|.|.|..     :..::....||.:.|.|.:......
  Fly   316 RKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ-----RPQSMEADVGSVVSLTCEVDSNPQP 375

  Fly   300 TVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQI 364
            .:.|::|.:.            ..||..|               |....::|   :....|.|:.
  Fly   376 EIVWIQHPSD------------RVVGTST---------------NLTFSVSN---ETAGRYYCKA 410

  Fly   365 STHPPRVIQINLHVNAPKVMIVDEVGDPL----QEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHM 425
            :......|..:.:|...        |.|.    :.:|..:..|.::.|      ..|||...:|:
  Fly   411 NVPGYAEISADAYVYLK--------GSPAIGSQRTQYGLVGDTARIEC------FASSVPRARHV 461

  Fly   426 DNILNYDVTRGGVSVKTELMED----------GANSTLSIAKISKTDSGNYTCS--------ISE 472
            ....|      |..:.:|...|          |..|||.|........|.|.|:        ::|
  Fly   462 SWTFN------GQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAE 520

  Fly   473 FQ-----NFTIVVHILNGES 487
            .|     :.::::.|:.|.|
  Fly   521 IQLQAKKSVSLLMTIVGGIS 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 13/86 (15%)
Ig 279..378 CDD:299845 14/98 (14%)
Ig 400..471 CDD:299845 18/88 (20%)
IG_like 402..480 CDD:214653 20/100 (20%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 20/102 (20%)
Ig 42..114 CDD:299845 10/73 (14%)
C2-set_2 135..225 CDD:285423 15/92 (16%)
Ig_3 265..329 CDD:290638 12/63 (19%)
I-set 346..420 CDD:254352 16/108 (15%)
Ig 360..425 CDD:299845 14/94 (15%)
Ig5_KIRREL3-like 428..524 CDD:143235 23/107 (21%)
IG_like 435..524 CDD:214653 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.