DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Kirrel1

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:311 Identity:79/311 - (25%)
Similarity:118/311 - (37%) Gaps:92/311 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 NRSTGLVRNSAVKVDSKHPLSKGQKTDAPML---NYIFDTFSSANKHHHHDQRYGPHFEDVQ-RI 273
            ||||.|:...:..:..| |....||..||.|   ..||.|.:.|             ....| |.
  Rat     5 NRSTCLMTCQSSLLPKK-PRFLSQKMWAPHLVVAYLIFVTLALA-------------LPGTQTRF 55

  Fly   274 GQ-ATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDK---R 334
            .| ..:.||.||....|.| :.|.....|.|.:              |.|.:||.  .|.|   |
  Rat    56 SQEPADQTVVAGHRAVLPC-VLLNYSGIVQWTK--------------DGLALGMG--QGLKAWPR 103

  Fly   335 YKM-----EFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPK--------VMIV 386
            |::     ..||    .|:||:.:..|:|.||||.:....|..:..|.|..|.        .:|:
  Rat   104 YRVVGSADAGQY----NLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRIDGGPVIL 164

  Fly   387 DEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVT-RGGVSVKTELMEDG-A 449
            .:.|.|           ..|:|...|....:::::::        |.| :.|....|||::|| .
  Rat   165 LQAGTP-----------YNLTCRAFNAKPAATIIWFR--------DGTQQEGAVTSTELLKDGKR 210

  Fly   450 NSTLSIAKISKTD---SGNYTC-SISEFQNFTIVVHILNGESFA---ELHH 493
            .:|:|...|..||   ...:|| |::|        .|.||:..:   ::||
  Rat   211 ETTISQLLIQPTDLDIGRVFTCRSMNE--------AIPNGKETSIELDVHH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 28/94 (30%)
Ig 279..378 CDD:299845 30/106 (28%)
Ig 400..471 CDD:299845 19/76 (25%)
IG_like 402..480 CDD:214653 20/83 (24%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 32/114 (28%)
Ig 57..148 CDD:299845 31/111 (28%)
Ig2_KIRREL3-like 170..251 CDD:143236 24/107 (22%)
I-set 255..336 CDD:254352
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.