DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr7

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:131/278 - (47%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTY 329
            |.|:|:    ...|::........|.||:....::||||:|...          |.:||..::||
  Fly    51 PFFDDI----SPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD----------LHILTTNIYTY 101

  Fly   330 TGDKRYKMEFQYP---NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGD 391
            |||:|:.:  .:|   .:|.|||...:..|..:||||::|.|...:.|.|.|      |.|....
  Fly   102 TGDQRFSV--IHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQV------IADNDFQ 158

  Fly   392 PLQEK--YYEI-----------------DSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGG 437
            .|:.|  :|:.                 |||:.|:|.| |:...|  |.|.|..:::::|..|||
  Fly   159 DLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSV-NIHAPS--VIWYHGSSVVDFDSLRGG 220

  Fly   438 VSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHST 502
            :|::||..:.|..|.|.:.:.|..|||||||..:.....::.||:|.||..|.:....|:...:.
  Fly   221 ISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAF 285

  Fly   503 WWNMVMLHAMALLVLNSL 520
            ...:.::....||.::||
  Fly   286 TAMITIISTKVLLYISSL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 28/89 (31%)
Ig 279..378 CDD:299845 31/101 (31%)
Ig 400..471 CDD:299845 29/87 (33%)
IG_like 402..480 CDD:214653 28/77 (36%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 30/104 (29%)
IG_like 58..140 CDD:214653 28/93 (30%)
IG_like 179..265 CDD:214653 30/88 (34%)
Ig 187..257 CDD:299845 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.