DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Tyro3

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:246 Identity:42/246 - (17%)
Similarity:88/246 - (35%) Gaps:61/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 IGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDL-LTVGMHTYTGDKRYK 336
            :|....:||..|..:.|||.:..:.|..:.|::     :|....||..: :::....:.|     
  Rat    36 MGAPVKMTVSQGQPVKLNCSVEGMDDPDIHWMK-----DGAVVQNASQVSISISEQNWIG----- 90

  Fly   337 MEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNA---------PKVMIVDEVGDP 392
                     .|.:.:.::.|..:|.||:.......|..::.:..         ||.:.|..    
  Rat    91 ---------LLSLKSAERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPP---- 142

  Fly   393 LQEKYYEIDSTLQLSCVVRNVAMTSSVVFWK---------HMDNILNYDVTRGGVSVKTEL---- 444
                    :...||||.........::.:|:         ...::||  ||  ||:.:||.    
  Rat   143 --------NVPFQLSCEAVGPPEPVTIFWWRGPTKVGGPASSPSVLN--VT--GVTQRTEFSCEA 195

  Fly   445 --MEDGANSTLSIAKISKTDSGNYTCSISEFQNFTI-VVHILNGESFAELH 492
              ::..|.|..:|.::....:..:..:::...:... |..:...:..|.||
  Rat   196 HNIKGLATSRPAIIRLQAPPAAPFNITVTTISSSNASVAWVPGADGLALLH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/87 (20%)
Ig 279..378 CDD:299845 18/99 (18%)
Ig 400..471 CDD:299845 16/85 (19%)
IG_like 402..480 CDD:214653 16/93 (17%)
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 18/104 (17%)
IGc2 46..111 CDD:197706 15/83 (18%)
Ig2_Tyro3_like 131..209 CDD:143226 18/93 (19%)
IG_like 135..204 CDD:214653 17/84 (20%)
FN3 215..307 CDD:238020 4/32 (13%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.