DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Ptprq

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq / 237523 MGIID:1096349 Length:2301 Species:Mus musculus


Alignment Length:499 Identity:95/499 - (19%)
Similarity:167/499 - (33%) Gaps:142/499 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SGLVQAKTIYDSVNMIQSLDALVEPRETTKVPLQTTPATPPTAHAHIHNQVSTLRS--------- 107
            :|::|..|||    :.:|........|||.:.| |........|..|....|||:.         
Mouse   788 NGIIQKYTIY----LKRSNSHEARTIETTSLTL-TIGGLKKYTHYVIEVSASTLKGEGVRSMPIS 847

  Fly   108 --SYEDSDDGVDGDYVIPESQTSTVAILDQDSSMKGQDM---------ESLSLQAGSGTVSPKSS 161
              :.||:.|....::.:.:....|| :|.....::...:         :.:||:..:.|......
Mouse   848 ILTEEDAPDSPPQNFSVKQLSGVTV-MLSWQPPLEPNGIILYYTVYVWDKVSLKTINATEVSLEL 911

  Fly   162 PDSSGHKKNASFQQIGSQNVNALVPATVAT--TSSGLPS-----------SSNASLATPTEPAR- 212
            .|...|...:::....::..:....::|..  |..|.||           ||::.:...|.|.: 
Mouse   912 SDLDYHADYSAYVTASTRFGDGKTRSSVINFRTPEGEPSDPPKDVHYVNLSSSSIILFWTPPVKP 976

  Fly   213 ------------NRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFS-------------S 252
                        |.|:..|:|..:...::.|   |..|.:..: |....||             :
Mouse   977 NGIIQYYSVYYQNTSSTFVQNFTLLEVTQEP---GNVTVSARI-YKLAVFSYYTFWLTASTLVGN 1037

  Fly   253 ANK-----HHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEG 312
            .||     |.:.||       |:.. |...|||.::.||..:|          |||.       .
Mouse  1038 GNKSSDVIHVYTDQ-------DIPE-GGVGNLTYESLSSTAIN----------VSWT-------P 1077

  Fly   313 KDNGNALDLLTVGMHTYTGDKRYKME--FQYPNNWRLKITNVKKDDEAIYECQISTHP--PRVIQ 373
            ....|.|....|.::......|::..  ..|.|:  :...|::|..:.|::...||..  .....
Mouse  1078 PSQPNGLVFYYVSLNLQQSPPRHRRPPLTTYENS--IYFDNLEKYTDYIFKITPSTEKGFSETYT 1140

  Fly   374 INLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFW----KHMDNILNYDVT 434
            ..||:...:                ::..|..:....:|::.||.::.|    |....||:|.:|
Mouse  1141 AQLHIKTEE----------------DVPDTPPIINTFKNLSSTSILLSWDPPLKPNGAILSYHLT 1189

  Fly   435 RGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTI 478
            ..|..         ||.|.       ..|||:.. :.|...||:
Mouse  1190 LQGTH---------ANRTF-------VTSGNHIV-LEELSPFTL 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 18/88 (20%)
Ig 279..378 CDD:299845 20/102 (20%)
Ig 400..471 CDD:299845 17/74 (23%)
IG_like 402..480 CDD:214653 20/81 (25%)
PtprqNP_001357916.1 FN3 57..151 CDD:238020
FN3 308..393 CDD:238020
fn3 399..>441 CDD:365830
FN3 570..654 CDD:238020
fn3 668..744 CDD:365830
FN3 762..850 CDD:238020 16/66 (24%)
fn3 857..934 CDD:365830 8/77 (10%)
FN3 951..1049 CDD:238020 17/101 (17%)
FN3 1056..1137 CDD:238020 21/99 (21%)
FN3 1152..1233 CDD:238020 20/82 (24%)
FN3 1247..1337 CDD:238020
FN3 1342..1421 CDD:238020
FN3 1432..1535 CDD:238020
FN3 1542..1638 CDD:238020
FN3 1645..1734 CDD:238020
UP_III_II 1759..1928 CDD:297589
R-PTPc-Q 2033..2256 CDD:350464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.