DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and zig-3

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:280 Identity:62/280 - (22%)
Similarity:100/280 - (35%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQ 282
            |:..|.:...|.||||.|:.. |.:.|.:.:..|:     |...:  |..:.::  |...| ||.
 Worm     3 LICISVLAAISAHPLSSGEMR-AAVSNLVREIDST-----HLTTK--PSLKIIE--GLEDN-TVS 56

  Fly   283 AGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP----- 342
            .|.|:.|.|.:.......:.|.:...:.:|....|..:.:...|............:|.|     
 Worm    57 TGESVTLRCDVLSTPTGVIYWEKDGQRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLH 121

  Fly   343 --NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQ 405
              .:::...||  ..|......:||.....|...:...:||.:.:..|....||      |:...
 Worm   122 HIGSYKCVATN--GHDTVESSAKISVEGQTVKCKSTRRSAPVITMSTESRFELQ------DNAAT 178

  Fly   406 LSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSI 470
            |.|.....|..:    |...|..:::|      |.:.||:..|   .|.|.||..:|.|:|.|  
 Worm   179 LICRADRRANWN----WMFEDKKIDFD------SGRYELLPSG---DLLIRKIQWSDMGSYFC-- 228

  Fly   471 SEFQNFTIVVHILNGESFAE 490
                    :.|...|||..|
 Worm   229 --------IAHNKYGESRGE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 16/93 (17%)
Ig 279..378 CDD:299845 18/105 (17%)
Ig 400..471 CDD:299845 19/70 (27%)
IG_like 402..480 CDD:214653 18/77 (23%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 18/104 (17%)
Ig 61..142 CDD:143165 11/82 (13%)
IG_like 177..244 CDD:214653 23/87 (26%)
Ig <191..237 CDD:299845 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.