DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and zig-2

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:268 Identity:51/268 - (19%)
Similarity:96/268 - (35%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 NSAVKVDSKHPLSKGQKTDA-PMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAG 284
            |:|..||.:.|:   :..|: |:|.:                         .|....:|:|.  |
 Worm    13 NAAESVDHQKPI---RALDSQPLLKF-------------------------TRTPNDSNVTF--G 47

  Fly   285 SSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALD-LLTVGMHTYTGDKRYKMEFQYPNNWRLK 348
            ....|:|..:.....::.|..:..:.:|::..|..: :|..|       |:........:::|:.
 Worm    48 EKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDG-------KQVSNAAMVSSHYRIP 105

  Fly   349 ITNVKKDDEAIYECQIST------HPPRVI----QINLHVN---APKV-MIVD---EVGDPLQEK 396
            ....:  :...|:|.|..      |..:|.    :.|..:|   ||.: |.||   |:.      
 Worm   106 CATAR--NSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEIS------ 162

  Fly   397 YYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
                ::.:.|||    .:.|::...|...:.:|..|..|      .::...|   .|.|..||.:
 Worm   163 ----NNAVALSC----RSETATEWSWHKGEQLLTNDGER------YQMFPSG---DLIIRNISWS 210

  Fly   462 DSGNYTCS 469
            |.|.|.|:
 Worm   211 DMGEYNCT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 14/87 (16%)
Ig 279..378 CDD:299845 17/109 (16%)
Ig 400..471 CDD:299845 17/70 (24%)
IG_like 402..480 CDD:214653 17/68 (25%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 18/135 (13%)
Ig 34..121 CDD:299845 16/122 (13%)
Ig <179..232 CDD:299845 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.