DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and zig-4

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:288 Identity:58/288 - (20%)
Similarity:97/288 - (33%) Gaps:93/288 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PTAHAHIHNQVSTLRSSYEDSDDGVDGDYVIPESQTSTVAILDQDSSMKGQDMESLSLQAGSGTV 156
            |..||.:|:.|.||.:.       :|.:|:...::...||.|:.            :|..|..|.
 Worm    18 PPMHAEMHSAVVTLANE-------IDTNYLTSPAKIKIVAPLES------------ALIPGGETY 63

  Fly   157 SPK----SSPDSSGH-KKNASFQQIGSQNVNA---LVPATVATTSSGL---------PSSSNASL 204
            ..:    |:|.::.| |.|....| ||..:|.   |:....|...:|:         ||:.|:  
 Worm    64 QLRCDIMSTPAATIHWKFNGKLIQ-GSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENS-- 125

  Fly   205 ATPTEPARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFED 269
            .|.:....|....:...:.|:::.:....:.....||.:.:..|:                .|| 
 Worm   126 GTYSCVGYNGHQTIETVAEVEIEGEASGCRSNHKSAPEIVFWTDS----------------RFE- 173

  Fly   270 VQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKR 334
                        ..|:...|.||    .::.|.||..:..:..|:|                || 
 Worm   174 ------------MTGNVATLVCR----ANQQVDWVWMSNDELVKNN----------------DK- 205

  Fly   335 YKMEFQYPNNWRLKITNVKKDDEAIYEC 362
                |...:|..|.|.|:..||...|.|
 Worm   206 ----FTVLSNGDLVIKNIVWDDMGTYTC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 20/85 (24%)
Ig 279..378 CDD:299845 20/84 (24%)
Ig 400..471 CDD:299845
IG_like 402..480 CDD:214653
zig-4NP_509335.1 I-set 47..147 CDD:254352 24/114 (21%)
Ig 65..144 CDD:143165 17/81 (21%)
IG_like 176..245 CDD:214653 20/79 (25%)
Ig <193..238 CDD:299845 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.