DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and igcm-2

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:245 Identity:52/245 - (21%)
Similarity:89/245 - (36%) Gaps:68/245 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QAGSSIHLNCRISLLQDKTVS--WVRHNTQ----DEGKDNGNALDLL--TVGMHTYTGDKRYKME 338
            :||:.|.|.|.|||..:::.|  | |.:.|    ..|::.|:....|  .:....:.|       
 Worm    26 KAGAPITLPCSISLFNEESFSLDW-RKDGQLILSAFGQEQGHVTPTLQGRLARDGFLG------- 82

  Fly   339 FQYPNNWRLKITNVKKDDEAIYECQIS------THPPRVIQINLHVNAPKVMIVDEVGDPLQEKY 397
                    :.|.:|...|..:|:|.::      |.|.:.:...|.||.|.|:|.......:.:| 
 Worm    83 --------ITIHSVTDGDAGVYQCIVTKFSKQPTRPEKGLSAKLVVNVPPVIISPSKNAIIHKK- 138

  Fly   398 YEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTD 462
              :.:.|...|.....  .|..:.|...:.|::                  .:..|:::.:.:.|
 Worm   139 --VGADLIFECKAEGA--PSPEITWSRNEQIIS------------------TSPVLTLSNLEEGD 181

  Fly   463 SGNYTC-----------SIS-EFQNFTIVVHILNGESFAELHHGGAVGWH 500
            .|.|||           ||. .|...||:..|...::..|   |..|.||
 Worm   182 KGLYTCLAVNIEGNSTSSIDVRFTKATILDLIPLNKTVIE---GSNVFWH 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/90 (23%)
Ig 279..378 CDD:299845 24/109 (22%)
Ig 400..471 CDD:299845 12/81 (15%)
IG_like 402..480 CDD:214653 16/89 (18%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 21/90 (23%)
Ig 124..200 CDD:386229 14/98 (14%)
IG_like 214..298 CDD:214653 5/18 (28%)
Ig_3 309..371 CDD:372822
Ig 389..467 CDD:386229
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.