DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and zig-8

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:227 Identity:56/227 - (24%)
Similarity:95/227 - (41%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQY 341
            |.:.|.|.:..:|:|.:....:..::|.|   ..:|.       |||.|..|:|.|.|:::..:.
 Worm    43 TIVNVVAENPAYLHCSVPPDAEHEIAWTR---VSDGA-------LLTAGNRTFTRDPRWQVSKKS 97

  Fly   342 PNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQL 406
            .|.|.|.:...::.|...|.|:|:.....|..:.|.|..|.:    .....||:|..::.:.:..
 Worm    98 ANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPL----PSPSSLQKKSTKLMANMSG 158

  Fly   407 SCVVRNVAMTSS-------VVFWKHMDNILNYDVTR---------GGVSVKTELMEDGANSTLSI 455
            ..||.|..:||:       .|.|....|.:|::.|.         .||.::          |:.|
 Worm   159 DEVVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIE----------TMRI 213

  Fly   456 AKISKTDSGNYTCSISEFQNFTIVVHILNGES 487
            .|.:..|.|||.|..|: |..:.:|||...|:
 Worm   214 RKATMEDDGNYACEHSQ-QKASQIVHINKAEA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 23/90 (26%)
IG_like 278..365 CDD:214653 21/86 (24%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 0/3 (0%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 1/2 (50%)
IG_like 402..480 CDD:214653 22/93 (24%)
Ig strand B 404..408 CDD:409353 0/3 (0%)
Ig strand C 417..423 CDD:409353 2/12 (17%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
zig-8NP_499714.1 Ig strand B 53..57 CDD:409353 1/3 (33%)
IG_like 55..134 CDD:214653 22/88 (25%)
Ig strand C 66..72 CDD:409353 2/8 (25%)
Ig strand E 101..105 CDD:409353 2/3 (67%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig 158..238 CDD:472250 22/90 (24%)
Ig strand B 161..165 CDD:409353 2/3 (67%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand F 223..228 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.