DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and zig-8

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:227 Identity:56/227 - (24%)
Similarity:95/227 - (41%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQY 341
            |.:.|.|.:..:|:|.:....:..::|.|   ..:|.       |||.|..|:|.|.|:::..:.
 Worm    43 TIVNVVAENPAYLHCSVPPDAEHEIAWTR---VSDGA-------LLTAGNRTFTRDPRWQVSKKS 97

  Fly   342 PNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQL 406
            .|.|.|.:...::.|...|.|:|:.....|..:.|.|..|.:    .....||:|..::.:.:..
 Worm    98 ANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPL----PSPSSLQKKSTKLMANMSG 158

  Fly   407 SCVVRNVAMTSS-------VVFWKHMDNILNYDVTR---------GGVSVKTELMEDGANSTLSI 455
            ..||.|..:||:       .|.|....|.:|::.|.         .||.::          |:.|
 Worm   159 DEVVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIE----------TMRI 213

  Fly   456 AKISKTDSGNYTCSISEFQNFTIVVHILNGES 487
            .|.:..|.|||.|..|: |..:.:|||...|:
 Worm   214 RKATMEDDGNYACEHSQ-QKASQIVHINKAEA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/86 (24%)
Ig 279..378 CDD:299845 24/98 (24%)
Ig 400..471 CDD:299845 20/86 (23%)
IG_like 402..480 CDD:214653 22/93 (24%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 22/88 (25%)
Ig 55..129 CDD:143165 21/83 (25%)
ig 158..229 CDD:278476 20/80 (25%)
IG_like 158..227 CDD:214653 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.