DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and rig-5

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:206 Identity:46/206 - (22%)
Similarity:76/206 - (36%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 GSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP------ 342
            |..:...|.::.|....|::|:.::...         ||:.....:....:|:::   |      
 Worm    99 GQDVDFTCIVNDLGSHMVAFVKADSPPR---------LLSFDEKVFRRRNKYELK---PRIGDLH 151

  Fly   343 NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLS 407
            |.|.|.|.||::.|...|.|||:|.|..:....|.|..|.|                :..:...:
 Worm   152 NEWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKV
PPV----------------VSRSTPAA 200

  Fly   408 CVVR---NVAMT-------SSVVFWKHMD-NILNYDVTRG-GVSVKTELMEDGANSTLSIAKISK 460
            ..||   ||::|       :..|.|:..| .|:.|:...| |.||       .....|.:.|:|:
 Worm   201 VEVREGNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASV-------FHGPVLHLTKVSR 258

  Fly   461 TDSGNYTCSIS 471
            .....|.|..|
 Worm   259 KHMSEYLCVAS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 19/86 (22%)
Ig 279..378 CDD:299845 23/99 (23%)
Ig 400..471 CDD:299845 19/82 (23%)
IG_like 402..480 CDD:214653 20/82 (24%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 24/101 (24%)
Ig_3 191..270 CDD:372822 21/102 (21%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.