Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001251131.1 | Gene: | rig-5 / 172791 | WormBaseID: | WBGene00004372 | Length: | 482 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 76/206 - (36%) | Gaps: | 53/206 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 GSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP------ 342
Fly 343 NNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLS 407
Fly 408 CVVR---NVAMT-------SSVVFWKHMD-NILNYDVTRG-GVSVKTELMEDGANSTLSIAKISK 460
Fly 461 TDSGNYTCSIS 471 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 19/86 (22%) |
Ig | 279..378 | CDD:299845 | 23/99 (23%) | ||
Ig | 400..471 | CDD:299845 | 19/82 (23%) | ||
IG_like | 402..480 | CDD:214653 | 20/82 (24%) | ||
rig-5 | NP_001251131.1 | IG_like | 92..189 | CDD:214653 | 24/101 (24%) |
Ig_3 | 191..270 | CDD:372822 | 21/102 (21%) | ||
IG | 294..380 | CDD:214652 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |