DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Kirrel

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:95/244 - (38%) Gaps:83/244 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 TVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDK---RYKM---- 337
            ||.||....|.| :.|.....|.|.:              |.|.:||.  .|.|   ||::    
Mouse    63 TVVAGQRAVLPC-VLLNYSGIVQWTK--------------DGLALGMG--QGLKAWPRYRVVGSA 110

  Fly   338 -EFQYPNNWRLKITNVKKDDEAIYECQISTH-------------PPRVIQINLHVNAPKVMIVDE 388
             ..||    .|:||:.:..|:|.||||.:..             ||...:|:   ..|.:::  :
Mouse   111 DAGQY----NLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRID---GGPVILL--Q 166

  Fly   389 VGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVT-RGGVSVKTELMEDG-ANS 451
            .|.|           ..|:|...|....:::::::        |.| :.|....|||::|| ..:
Mouse   167 AGTP-----------YNLTCRAFNAKPAATIIWFR--------DGTQQEGAVTSTELLKDGKRET 212

  Fly   452 TLSIAKISKTD---SGNYTC-SISEFQNFTIVVHILNGESFA---ELHH 493
            |:|...|..||   ...:|| |::|        .|.||:..:   ::||
Mouse   213 TISQLLIEPTDLDIGRVFTCRSMNE--------AIPNGKETSIELDVHH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 28/92 (30%)
Ig 279..378 CDD:299845 31/118 (26%)
Ig 400..471 CDD:299845 19/76 (25%)
IG_like 402..480 CDD:214653 20/83 (24%)
KirrelXP_011238330.1 Ig 54..148 CDD:386229 28/105 (27%)
Ig2_KIRREL3-like 170..251 CDD:143236 24/107 (22%)
Ig 255..336 CDD:386229
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.