DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr12

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_061503626.1 Gene:dpr12 / 1276929 VectorBaseID:AGAMI1_006198 Length:317 Species:Anopheles gambiae


Alignment Length:177 Identity:49/177 - (27%)
Similarity:80/177 - (45%) Gaps:30/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKT------VSWVRHNTQ 309
            ||....:|.|.......:|.:.:  |.|.|||.|....|.|:::.: |:.      :||:|... 
Mosquito    46 SSGRIDNHLDSSDSTLIDDGEVM--AHNTTVQLGGVAFLVCKVAGV-DRVGVNWNQISWIRRRD- 106

  Fly   310 DEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP--NNWRLKITNVKKDDEAIYECQISTHPPRVI 372
                     ..:|:.|...||.|:|:.: ...|  |.|.|:|..|::.|...||||:|| |..:|
Mosquito   107 ---------WHILSSGAQMYTNDERFAI-LHTPGSNTWTLQIKFVQRRDHGTYECQVST-PTGII 160

  Fly   373 Q--INLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTS 417
            .  :||.|..|:..|:..     .|.:.::.||:.|.|::.....|:
Mosquito   161 SHFVNLQVVVPEAFILGS-----GELHVDMGSTINLVCIIEKPTATA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 36/124 (29%)
IG_like 278..365 CDD:214653 28/94 (30%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/9 (11%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 3/4 (75%)
Ig strand G 371..374 CDD:409382 1/4 (25%)
IG_like 402..480 CDD:214653 5/16 (31%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 0/1 (0%)
Ig strand E 451..455 CDD:409353
dpr12XP_061503626.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.