DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and ntm

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:308 Identity:74/308 - (24%)
Similarity:119/308 - (38%) Gaps:76/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 NRSTGL-VRNSAVKVDSKHPLSKGQKT--DAPMLNY-IFD----TFSSANKHH------HHDQRY 263
            ||||.| ..|....:|.:..|....|:  ...:.|. |:|    |.|....:|      |...:.
 Frog    71 NRSTILYTGNDKWSIDPRVVLLANTKSQYSIEIQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQV 135

  Fly   264 GPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHT 328
            .|...|:     ::::.|..||::.|.|..:...:..|:|...:.:..|                
 Frog   136 PPRIVDI-----SSSIAVNEGSNVSLICIANGRPEPVVNWRYLSPKARG---------------- 179

  Fly   329 YTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQIS--THPPRVIQINLHVN-APKVMIVDEVG 390
                  :..|.:|     |:||.:.::...||||..|  ...|.|.::.|.|| .|.::....:|
 Frog   180 ------FVSEDEY-----LEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYILDAQNIG 233

  Fly   391 DPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSI 455
            .||..:..       |.|...  |:.::..||...|..|: |..||   ||.|..|  ..|.::.
 Frog   234 APLGHRGI-------LQCEAS--AVPAADFFWYKEDKRLS-DSWRG---VKVENRE--TISRVTF 283

  Fly   456 AKISKTDSGNYTC---SISEFQNFTIVVH---------ILNGESFAEL 491
            ..:|:.|.|||||   ::....|.:|::.         :|..||.|.|
 Frog   284 LNVSEQDYGNYTCMAKNLLGHSNASIILFELFQSTSSPLLQEESTAAL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/86 (20%)
Ig 279..378 CDD:299845 21/100 (21%)
Ig 400..471 CDD:299845 22/73 (30%)
IG_like 402..480 CDD:214653 24/80 (30%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 16/61 (26%)
IG_like 45..133 CDD:214653 16/61 (26%)
IG_like 143..220 CDD:214653 21/103 (20%)
IGc2 150..209 CDD:197706 17/85 (20%)
ig 227..311 CDD:278476 27/98 (28%)
IG_like 230..311 CDD:214653 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.