DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and si:ch211-264f5.6

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002665524.2 Gene:si:ch211-264f5.6 / 100319064 ZFINID:ZDB-GENE-081104-208 Length:540 Species:Danio rerio


Alignment Length:465 Identity:90/465 - (19%)
Similarity:168/465 - (36%) Gaps:122/465 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLLIATIMG---SGLVQAKTIYDSVNMIQSLDALVEPRETTKVPLQTTPATPPTAHAHIHNQVST 104
            :|.|.|..|   :|.:..: :.:.|..::....::||.|.....:.|..|.....:..|:..|..
Zfish   109 ILTIVTNNGDLVTGQIDLE-VLEPVTDVKISSNVLEPVEFNSTVVLTCSAKGSFTYKWINGSVPL 172

  Fly   105 LRSSYEDSDDGVDGDYVIPESQTSTVAILDQDSSMKGQDME-------------------SLSLQ 150
            :          |||.::    |.:.|....:.|.::..|::                   :|::.
Zfish   173 V----------VDGTHM----QLNAVGNELKISEVRRTDLQGPIVCIAENALESGKSAPFNLTVS 223

  Fly   151 AGSGTVSPKSSPDSSGHKKNASFQQIGSQNVNALVPATVATTSSGLPSSSNASLATPTEPARN-- 213
            .|...:.....|..:..||.::.....:.:.|.  |||:....:|:...||| :::|.....|  
Zfish   224 YGPENILMNQFPTDTYLKKGSTLTLTCTADSNP--PATIQWVFNGVNLPSNA-VSSPANFTLNNL 285

  Fly   214 --RSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNY--IFDTFSSANKHHHHDQRYGPHFEDVQRIG 274
              :::|.....|....:|..:       |..:.:  :.::.|..|                  |.
Zfish   286 EEKNSGNYTCVAYNAQTKRYI-------ASRVAFVTVVESLSGTN------------------IS 325

  Fly   275 QATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKD-NGNALDLLTVGMHTYTGDKRYKME 338
            .:|:|.:...|:::|.|..:..:.:||.||:     :||. |.::..:.:....:.:.||..|.:
Zfish   326 SSTSLLIAGNSTVNLTCFAAAGRAETVEWVK-----DGKPLNPDSRIVFSADKTSVSIDKVVKED 385

  Fly   339 FQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDST 403
               ...:|..:.|....|||.|..:|:..|.:|.....|.    |...|:|              
Zfish   386 ---RGEYRCLLRNKVNKDEASYNLKINYGPEKVAVQGKHA----VKFEDDV-------------- 429

  Fly   404 LQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISK-TDSGNYT 467
             :|||...:|  ..|...||.....||                  ::..:.:.|.:| .|||.||
Zfish   430 -ELSCTAESV--PPSTYTWKLNGTALN------------------SSQQVYVVKRAKDRDSGIYT 473

  Fly   468 CSISEFQNFT 477
            |  ..|.|.|
Zfish   474 C--EAFNNIT 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 20/87 (23%)
Ig 279..378 CDD:299845 23/99 (23%)
Ig 400..471 CDD:299845 17/71 (24%)
IG_like 402..480 CDD:214653 20/77 (26%)
si:ch211-264f5.6XP_002665524.2 Ig 33..129 CDD:299845 5/20 (25%)
IG_like 33..128 CDD:214653 5/19 (26%)
Ig 130..222 CDD:299845 16/105 (15%)
IG_like 149..222 CDD:214653 12/86 (14%)
I-set 233..315 CDD:254352 17/91 (19%)
Ig_2 235..315 CDD:290606 17/89 (19%)
IGc2 335..398 CDD:197706 15/70 (21%)
Ig_2 427..494 CDD:290606 22/92 (24%)
IG_like 427..479 CDD:214653 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.