DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and kirrel1b

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:545 Identity:101/545 - (18%)
Similarity:200/545 - (36%) Gaps:145/545 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IATIMGSG-----LVQAKTIYDSVNMIQSLDALVEPRE---TTKVP-----LQTTPATPPTAHAH 97
            :..||..|     :..|....||:...|:.:|.:..|.   |..:|     ::.:|....||...
Zfish    78 VLRIMDVGQYNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPVIEGSPEILLTAGTS 142

  Fly    98 IH----NQVSTLRSSYEDSDDGVDGDYVIPESQTSTVAILDQ-----DSSMKGQDMESLSLQAGS 153
            .:    ::.:...|:.|...||:    ::..:.|||..:.|:     .|.::.|.|::.:.:..:
Zfish   143 FNLTCVSRGAKPMSTIEWYKDGI----IVEGAHTSTEVLSDRKRVTTKSFLEIQPMDTDTGRNFT 203

  Fly   154 GTVSPKSSPDSSGHKKNASFQQIGSQN---VNALVPATVATT--------SSGLPSSSNASLATP 207
            ...|..::|             :|.::   :|...|.||..:        ...:..:..|:...|
Zfish   204 CVASNLAAP-------------LGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPP 255

  Fly   208 TEPARNRSTGLV----RNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFE 268
            ....|....|::    |.|..:..:.|..     ...|:...:|:...|.|.....|..:||.. 
Zfish   256 IMGYRWAKGGVILDGARESVFETTADHSF-----FTEPVSCLVFNAVGSTNVSILVDVHFGPIL- 314

  Fly   269 DVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDK 333
                :.:...:||...|.:.|||:.|.....|::|.:         .|:::.|            
Zfish   315 ----VVEPRPVTVDVDSDVTLNCKWSGNPPLTLTWTK---------KGSSMVL------------ 354

  Fly   334 RYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRV----IQINLHVNAPKVMIVDEVGDPLQ 394
                    .|:.:|.:.:|.:.|...|.|:...  ||:    .::.|.||.|.::    ..:|:|
Zfish   355 --------SNSNQLFLKSVSQADAGQYVCKAIV--PRIGVGETEVTLTVNGPPII----SSEPIQ 405

  Fly   395 EKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNIL---------NYDV------TRGGVSVKTEL 444
              |.......::.|.:.:......:| |...:|:.         .|.|      |:||..:    
Zfish   406 --YAVRGEKGEIKCYIASTPPPDKIV-WAWKENVWEKERGTLLERYTVEQSRPATQGGAVL---- 463

  Fly   445 MEDGANSTLSIAKISKTD-SGNYTCSI-SEFQNFTIVVHILNGESFAE------LHHGGAVGWHS 501
                  |||:|..:.:.| ...|.|:. :.|...|:::.:...:..:|      :..||:||  |
Zfish   464 ------STLTINNVMEADFQSTYNCTAWNAFGPGTMIITLEETDIASEDIVPVGVIAGGSVG--S 520

  Fly   502 TWWNMVMLHAMALLVL----NSLRG 522
            :...:::|.|:...:.    :|.||
Zfish   521 SILLLLLLFALIFYLYRQRKSSRRG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/86 (20%)
Ig 279..378 CDD:299845 20/102 (20%)
Ig 400..471 CDD:299845 16/87 (18%)
IG_like 402..480 CDD:214653 18/94 (19%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.