| Sequence 1: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
| Alignment Length: | 197 | Identity: | 41/197 - (20%) |
|---|---|---|---|
| Similarity: | 76/197 - (38%) | Gaps: | 40/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
Fly 341 YPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEI----D 401
Fly 402 STLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNY 466
Fly 467 TC 468 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 21/88 (24%) |
| Ig | 279..378 | CDD:299845 | 21/100 (21%) | ||
| Ig | 400..471 | CDD:299845 | 16/73 (22%) | ||
| IG_like | 402..480 | CDD:214653 | 15/67 (22%) | ||
| lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | 24/110 (22%) |
| FR1 | 38..54 | CDD:409353 | 6/16 (38%) | ||
| Ig strand A' | 39..45 | CDD:409353 | 3/4 (75%) | ||
| Ig strand B | 47..55 | CDD:409353 | 2/10 (20%) | ||
| CDR1 | 55..59 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..67 | CDD:409353 | 2/18 (11%) | ||
| Ig strand C | 60..66 | CDD:409353 | 2/17 (12%) | ||
| CDR2 | 68..78 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 70..73 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 75..78 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 79..114 | CDD:409353 | 10/34 (29%) | ||
| Ig strand D | 83..90 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 93..99 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 106..114 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 115..119 | CDD:409353 | 1/11 (9%) | ||
| Ig strand G | 119..128 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 121..128 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 131..206 | CDD:404760 | 16/83 (19%) | ||
| Ig strand A' | 138..143 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 149..156 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 162..167 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 173..175 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 185..191 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 198..205 | CDD:409353 | 3/5 (60%) | ||
| Ig strand G | 212..220 | CDD:409353 | |||
| Ig_3 | 223..302 | CDD:404760 | |||
| putative Ig strand A | 224..230 | CDD:409353 | |||
| Ig strand B | 240..244 | CDD:409353 | |||
| Ig strand C | 253..257 | CDD:409353 | |||
| Ig strand E | 281..285 | CDD:409353 | |||
| Ig strand F | 295..300 | CDD:409353 | |||
| Ig strand G | 308..311 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||