DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and lsamp

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:197 Identity:41/197 - (20%)
Similarity:76/197 - (38%) Gaps:40/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKT--VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQ 340
            |:||:.|.:..|.|   .::|::  |:|:            |...::..|...::.|.|.::|.:
 Frog    40 NITVRQGDTAILRC---FVEDRSSRVAWL------------NRSGIIFAGDDKWSLDPRVELEKR 89

  Fly   341 YPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEI----D 401
            ....:.|:|..|...||..|.|.:.|        ..|....:|.::.:|...:.....:|    .
 Frog    90 SLLEYSLRIQKVDVSDEGPYTCSVQT--------KQHTKTTQVYLIVQVPPKISNISADITVNEG 146

  Fly   402 STLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNY 466
            |.:.|.|:.  ......::.|:|:       ....|.|...:.  :|....|.|..|::..||.|
 Frog   147 SNVTLMCIA--YGRPEPMITWRHL-------TPTAGTSPARDF--EGEEEFLEIQGITREQSGRY 200

  Fly   467 TC 468
            .|
 Frog   201 EC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 22/91 (24%)
IG_like 278..365 CDD:214653 21/88 (24%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/5 (20%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 15/67 (22%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
lsampXP_031751462.1 Ig 38..128 CDD:472250 24/110 (22%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 61..65 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 121..124 CDD:409353 0/2 (0%)
Ig_3 131..206 CDD:464046 16/83 (19%)
Ig_3 223..302 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.