DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Echs1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444349.1 Gene:Echs1 / 93747 MGIID:2136460 Length:290 Species:Mus musculus


Alignment Length:258 Identity:64/258 - (24%)
Similarity:119/258 - (46%) Gaps:13/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQGK---LLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSG 67
            ::.::.|::||   :.:.:.|.||..|.:.....:|:.:.|.....|..|..:|.||....|.:|
Mouse    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAG 97

  Fly    68 NDLSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETT 132
            .|:.:..|....|.:    ::.|.:........:|.|:|.|||.|:|.|..:..:||:.:..|..
Mouse    98 ADIKEMQNRTFQDCY----SSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKA 158

  Fly   133 YFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIW 197
            .|..|...||.:|..|.:..|...:|:|.|.|::|..:.:|||:|.|...||:||   .:|.::.
Mouse   159 QFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIF---PVEKLVE 220

  Fly   198 PKLRQYSELPTNS---LLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRK 257
            ..::...::.:||   :...|..|...|...|.:.|:.|.:.....|...:..:.:..|..::
Mouse   221 EAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 54/190 (28%)
Echs1NP_444349.1 crotonase-like 32..288 CDD:304874 64/258 (25%)
PRK05617 36..288 CDD:235533 64/255 (25%)
Substrate binding. /evidence=ECO:0000250 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.