DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CDY1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_004671.1 Gene:CDY1 / 9085 HGNCID:1809 Length:554 Species:Homo sapiens


Alignment Length:240 Identity:70/240 - (29%)
Similarity:124/240 - (51%) Gaps:14/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQ-GKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGND 69
            |::::|::: |...:.......:||.:|....:|:...|.....|:. .:|:|:..|.:|..|.|
Human   283 YRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEIVNALNSAAADDS-KLVLFSAAGSVFCCGLD 346

  Fly    70 -------LSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAW 127
                   |..:.||..::..     .|.|..|.:|:..:|.::..|||||||:||:|:.|||:.|
Human   347 FGYFVKHLRNNRNTASLEMV-----DTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVW 406

  Fly   128 CSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASEL 192
            .:|..:|.||:|..|..|:|.||...|.::|::.|:|:|:....|:|:||.....||::|.....
Human   407 ANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTF 471

  Fly   193 ESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQL 237
            ...:..::::.:......|.:.|.||:......|.:|||.||:.|
Human   472 TQEVMIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 58/195 (30%)
CDY1NP_004671.1 CHROMO 5..58 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..106
crotonase-like 286..482 CDD:119339 58/201 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4209
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42274
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.