DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and DCI1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_014823.3 Gene:DCI1 / 854352 SGDID:S000005706 Length:271 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:63/243 - (25%)
Similarity:109/243 - (44%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSG------NDLSQS 73
            |...:.|..:||..|.:....:..:..:|.:.||.:.|...|....|..|:||      |.|:..
Yeast    11 GPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLFTVLQSSGKYFSSGGKFSAVNKLNDG 75

  Fly    74 SNTDDIDAFFKQSNATFKAMVL---SFVNCRKIVLALVNGPAIGIGATIVGLCDVAWC-SETTYF 134
            ..|.:::...|..:|.....:.   :|...:|:::..:||||||:.|::|.|||:.:. :::.:.
Yeast    76 DVTSEVEKVSKLVSAISSPNIFVANAFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFL 140

  Fly   135 YTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEA--------YQFNFVSRIFKASE 191
            ..||:.||.|.|.|:|..|...||.:.|:|.::.|.|:..:|.        ||.. .:..|....
Yeast   141 LFPFSNLGFVAEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLT-NTETFNEKV 204

  Fly   192 LESV------IWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAE 233
            |:.:      ::||          |:|..|.|:.....:.||||...|
Yeast   205 LQDIKQNLEGLYPK----------SVLGMKELLHSEMKQKLIKAQAME 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 52/205 (25%)
DCI1NP_014823.3 CaiD 1..264 CDD:223955 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346018
Domainoid 1 1.000 78 1.000 Domainoid score I2062
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1537
Isobase 1 0.950 - 0 Normalized mean entropy S2085
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm46964
orthoMCL 1 0.900 - - OOG6_103916
Panther 1 1.100 - - LDO PTHR43684
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.