DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and EHD3

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_010321.1 Gene:EHD3 / 851606 SGDID:S000002443 Length:500 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:59/295 - (20%)
Similarity:108/295 - (36%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVV---------FTGVGD-- 62
            :|...|....|...|.|||.|.:|....:.|.:.|.|....:...:|:         |...||  
Yeast    39 VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVA 103

  Fly    63 ---IFTSGNDLSQSSN--TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGL 122
               ||....:.::|..  ||:....|:  .||:...:::|::      .:..|.  |:|.:|...
Yeast   104 TVAIFNFNKEFAKSIKFFTDEYSLNFQ--IATYLKPIVTFMD------GITMGG--GVGLSIHTP 158

  Fly   123 CDVAWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASE-----ILLLSEPLSAQEAYQFNF 182
            ..:|  :|.|.:..|...:|..|:.||::.||.|:..:.::.     :.|..|.::..:||....
Yeast   159 FRIA--TENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGL 221

  Fly   183 VSRIFKASELESV------IWPKLR-----------------------------QYSELPTNSLL 212
            .|....:..|:::      |.|...                             :||....|.:.
Yeast   222 ASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIE 286

  Fly   213 QGKRLVKDGFLENLIK-----ANEAECKQLLQQFQ 242
            ....|.|:|.:|:::.     ...||.|...|:.:
Yeast   287 ACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 46/214 (21%)
EHD3NP_010321.1 ECH_2 48..386 CDD:406503 57/286 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.