DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ECI1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_013386.1 Gene:ECI1 / 850990 SGDID:S000004274 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:66/267 - (24%)
Similarity:119/267 - (44%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLS--QSSNT 76
            :|...:....||...|.:....|..:..:|...:.:..|...:....|..|:||.|..  ..:..
Yeast    16 EGPFFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQG 80

  Fly    77 DDIDAFFKQSNATFKAMVL-------SFVNCRKIVLALVNGPAIGIGATIVGLCDVAW-CSETTY 133
            ||.:.:..:::......|.       :|:...|:::..:||||||:.|.:|.|||:.: .::..|
Yeast    81 DDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVY 145

  Fly   134 FYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIF-----KASELE 193
            ...||..|||:.|||::..|||..|.:...|.|:.::|.......:..|:|:.|     .|....
Yeast   146 LLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFN 210

  Fly   194 SVIWPKLRQYSE---LPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFAS 255
            :.:..:||:..:   ||  |.|..|:|:|...::...|||..|..:.|:.:...|..:......|
Yeast   211 AKVLEELREKVKGLYLP--SCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQLGS 273

  Fly   256 RKNKAKL 262
            ::.|.:|
Yeast   274 KQRKHRL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 48/197 (24%)
ECI1NP_013386.1 CaiD 6..243 CDD:223955 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346015
Domainoid 1 1.000 78 1.000 Domainoid score I2062
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74357
Inparanoid 1 1.050 91 1.000 Inparanoid score I1537
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm46964
orthoMCL 1 0.900 - - OOG6_103916
Panther 1 1.100 - - O PTHR43684
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3644
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.