DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and hadhab

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001082906.1 Gene:hadhab / 793834 ZFINID:ZDB-GENE-041111-204 Length:763 Species:Danio rerio


Alignment Length:258 Identity:60/258 - (23%)
Similarity:108/258 - (41%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EQQGKLLVAKFNNPKKKNCINRVAYQ---EMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDLSQ 72
            |.:|.:.|.:.|:|..|  :|.::.|   :||.|:.||..:..| ::|:.:.....|.:|.|:|.
Zfish    44 EVKGDVAVVRMNDPTAK--VNTLSVQMQKDMTEVMDEVWGNSAVQSVVLISSKPGCFIAGADISM 106

  Fly    73 ---SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD--VAWCSETT 132
               ....:::....::....|:.:..|    .|.::|.:||..:|.|......|.  :|..|:.|
Zfish   107 IKACKTAEEVTGLSQEGQRMFEKIEKS----PKPIVAAINGSCLGGGLEFAIACQYRIATKSKKT 167

  Fly   133 YFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIW 197
            ....|...|||:|..|.:..||.:||...|.:::|....:.|.:|.:...|      .:|...:.
Zfish   168 VLGCPEVMLGLLPGAGGTQRLPKMLGLPSAFDVMLTGRSIRADKAKKMGLV------HQLVDTLG 226

  Fly   198 PKLRQYSELPTNSLLQGKRLVKDGFLENLIK-ANEAECKQLLQQF--QHPEFAQAIIDFASRK 257
            |.|:...|.....|.:.......|..:..|. ..|....|.:|.:  .:|...|.|.:...:|
Zfish   227 PGLKSPEERTIEYLEEVAVEAARGLAQKKITLTKEKGWMQKIQDYVMSYPFVRQQIYNTVEKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 47/193 (24%)
hadhabNP_001082906.1 fa_ox_alpha_mit 27..762 CDD:131494 60/258 (23%)
crotonase-like 41..251 CDD:119339 51/218 (23%)
3HCDH_N 363..541 CDD:280833
3HCDH 544..639 CDD:279114
3HCDH 676..>750 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.