DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and cdyl

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:265 Identity:80/265 - (30%)
Similarity:135/265 - (50%) Gaps:24/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQGKLLVAKFN-NPKKKNCINRVAYQEM-TRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            |::::|::|.......|: ...:.|.:|....:|: :.:.|...||.  .:|:.:|||.:|..|.
Zfish   324 YRDIVVKKQDGFTHILFSTKTSENNSLNPDVMKEVQSAMATAAADDS--KLVLLSGVGSVFCFGL 386

  Fly    69 DLSQSSN--TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSET 131
            |......  |||......:...|.:..|.:|:..:|.::|.|||||||:||:|:.||||.|.:|.
Zfish   387 DFIYFIRRLTDDRKKESIKMAETIRTFVNTFIQFKKPIIAAVNGPAIGLGASILPLCDVIWANEK 451

  Fly   132 TYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVI 196
            .:|.||:|..|..|:..||...|||:|.:.|:|:||....|:||||.....||:         |:
Zfish   452 AWFQTPYTTFGQTPDACSSVTFPLIMGVASANEMLLSGRKLTAQEACAKGLVSQ---------VL 507

  Fly   197 WP---------KLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIID 252
            ||         ::::.....:..|.:.|.||::.....|.:|||.||:.|.:.:...:...:|:.
Zfish   508 WPGTFTQEVMVRIKELVSCNSVVLRESKALVRNINRAALEQANERECEALKRVWGSSQGMDSILK 572

  Fly   253 FASRK 257
            :..:|
Zfish   573 YLQKK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 64/191 (34%)
cdylXP_696879.5 CHROMO 8..61 CDD:214605
crotonase-like 327..523 CDD:119339 66/206 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.